GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 00:31:13, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_004821               1701 bp    mRNA    linear   PRI 07-SEP-2020
DEFINITION  Homo sapiens heart and neural crest derivatives expressed 1
            (HAND1), mRNA.
ACCESSION   NM_004821
VERSION     NM_004821.3
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1701)
  AUTHORS   Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall
            R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG,
            Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF,
            Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC,
            Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A,
            Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG,
            Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S,
            Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A,
            Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van
            Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S,
            Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli
            D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V,
            Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X,
            Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S,
            Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood
            MA.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   2  (bases 1 to 1701)
  AUTHORS   Li L, Wang J, Liu XY, Liu H, Shi HY, Yang XX, Li N, Li YJ, Huang
            RT, Xue S, Qiu XB and Yang YQ.
  TITLE     HAND1 loss-of-function mutation contributes to congenital double
            outlet right ventricle
  JOURNAL   Int. J. Mol. Med. 39 (3), 711-718 (2017)
   PUBMED   28112363
  REMARK    GeneRIF: These findings expand the phenotypic spectrum linked to
            HAND1 mutations, suggesting potential implications for the
            development of novelo prophylactic and therapeutic strategies for
            DORV.
REFERENCE   3  (bases 1 to 1701)
  AUTHORS   Wang J, Hu XQ, Guo YH, Gu JY, Xu JH, Li YJ, Li N, Yang XX and Yang
            YQ.
  TITLE     HAND1 Loss-of-Function Mutation Causes Tetralogy of Fallot
  JOURNAL   Pediatr Cardiol 38 (3), 547-557 (2017)
   PUBMED   27942761
  REMARK    GeneRIF: association of HAND1 loss-of-function mutation with
            increased susceptibility to Tetralogy of Fallot
REFERENCE   4  (bases 1 to 1701)
  AUTHORS   Asuthkar S, Guda MR, Martin SE, Antony R, Fernandez K, Lin J, Tsung
            AJ and Velpula KK.
  TITLE     Hand1 overexpression inhibits medulloblastoma metastasis
  JOURNAL   Biochem. Biophys. Res. Commun. 477 (2), 215-221 (2016)
   PUBMED   27297109
  REMARK    GeneRIF: Strikingly, human pluripotent stem cell antibody array
            showed that Hand1 overexpression resulted in substantial decrease
            in pluripotency markers (Nanog, Oct3/4, Otx2, Flk1) suggesting that
            Hand1 expression may be essential to attenuate the EMT and our
            findings underscore a novel role for Hand1 in medulloblastoma
            metastasis.
REFERENCE   5  (bases 1 to 1701)
  AUTHORS   Zhou,Y.M., Dai,X.Y., Qiu,X.B., Yuan,F., Li,R.G., Xu,Y.J., Qu,X.K.,
            Huang,R.T., Xue,S. and Yang,Y.Q.
  TITLE     HAND1 loss-of-function mutation associated with familial dilated
            cardiomyopathy
  JOURNAL   Clin. Chem. Lab. Med. 54 (7), 1161-1167 (2016)
   PUBMED   26581070
  REMARK    GeneRIF: HAND1 loss-of-function mutation is associated with
            familial dilated cardiomyopathy.
REFERENCE   6  (bases 1 to 1701)
  AUTHORS   Srivastava D.
  TITLE     HAND proteins: molecular mediators of cardiac development and
            congenital heart disease
  JOURNAL   Trends Cardiovasc. Med. 9 (1-2), 11-18 (1999)
   PUBMED   10189962
  REMARK    Review article
REFERENCE   7  (bases 1 to 1701)
  AUTHORS   Knofler M, Meinhardt G, Vasicek R, Husslein P and Egarter C.
  TITLE     Molecular cloning of the human Hand1 gene/cDNA and its
            tissue-restricted expression in cytotrophoblastic cells and heart
  JOURNAL   Gene 224 (1-2), 77-86 (1998)
   PUBMED   9931445
REFERENCE   8  (bases 1 to 1701)
  AUTHORS   Russell MW, Baker P and Izumo S.
  TITLE     Cloning, chromosomal mapping, and expression of the human eHAND
            gene
  JOURNAL   Mamm. Genome 8 (11), 863-865 (1997)
   PUBMED   9337404
REFERENCE   9  (bases 1 to 1701)
  AUTHORS   Cross SH, Charlton JA, Nan X and Bird AP.
  TITLE     Purification of CpG islands using a methylated DNA binding column
  JOURNAL   Nat. Genet. 6 (3), 236-244 (1994)
   PUBMED   8012384
REFERENCE   10 (bases 1 to 1701)
  AUTHORS   Weber,M.C., de Clarke,V., Harwin,R.M. and Shiff,C.J.
  TITLE     An extended field trial of pyrimethamine combined with dapsone in
            the prophylaxis of malaria
  JOURNAL   Cent Afr J Med 21 (9), 187-192 (1975)
   PUBMED   1182795
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF061756.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Nov 22, 2018 this sequence version replaced NM_004821.2.
            
            Summary: The protein encoded by this gene belongs to the basic
            helix-loop-helix family of transcription factors. This gene product
            is one of two closely related family members, the HAND proteins,
            which are asymmetrically expressed in the developing ventricular
            chambers and play an essential role in cardiac morphogenesis.
            Working in a complementary fashion, they function in the formation
            of the right ventricle and aortic arch arteries, implicating them
            as mediators of congenital heart disease. In addition, it has been
            suggested that this transcription factor may be required for early
            trophoblast differentiation. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC021190.2, AF061756.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2148874, SAMEA2153932
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000231121.3/ ENSP00000231121.2
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1324              AF061756.1         38-1361
            1325-1701           AF061756.1         1363-1739
FEATURES             Location/Qualifiers
     source          1..1701
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
                     /map="5q33.2"
     gene            1..1701
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /note="heart and neural crest derivatives expressed 1"
                     /db_xref="GeneID:9421"
                     /db_xref="HGNC:HGNC:4807"
                     /db_xref="MIM:602406"
     exon            1..762
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:555932965"
     variation       2
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1367450029"
     variation       5
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:937702512"
     variation       6
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1298357939"
     variation       19
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3822714"
     variation       25
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:979090975"
     variation       28
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:578193925"
     variation       32
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:971285115"
     variation       37
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1286950461"
     variation       40
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1449852614"
     variation       41
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1315309690"
     variation       43
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1432408330"
     variation       46
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1459234033"
     variation       47
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1311405094"
     variation       54
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1350463689"
     variation       55
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1020701010"
     variation       64
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:989016744"
     variation       65
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:956377661"
     variation       71
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1199772286"
     variation       74
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1422604116"
     variation       76
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1444185092"
     variation       77
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1204624151"
     variation       86
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1237725335"
     variation       90
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438238068"
     variation       92
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:993098"
     variation       94
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1364709746"
     variation       98
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1188601372"
     variation       105
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1478017242"
     variation       107
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1427601466"
     variation       111
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951376403"
     variation       114
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1470634742"
     variation       116
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337001543"
     variation       140..147
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="acaggtgg"
                     /replace="acaggtggacaggtgg"
                     /db_xref="dbSNP:995598774"
     variation       146
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1008861248"
     variation       147
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1489009690"
     variation       148
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181499341"
     variation       152
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1028318544"
     variation       153
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1008381755"
     variation       161
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:891304806"
     variation       165
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347222418"
     variation       166
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1344885437"
     variation       167
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224136564"
     variation       168
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:995457935"
     variation       170
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1439046361"
     variation       171
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:898609210"
     variation       173
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201748550"
     variation       175
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1290274638"
     variation       176
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781476191"
     variation       178
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1374652189"
     variation       179
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:549580359"
     variation       183
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:111403472"
     variation       185
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376145648"
     variation       189
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1395669524"
     variation       193
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:13171812"
     variation       194
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374096842"
     variation       196
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779569406"
     variation       197
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259675173"
     variation       198
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188528489"
     variation       202
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758014034"
     variation       203
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1379824109"
     variation       205
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:749996768"
     variation       206
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764963596"
     variation       208
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:754050287"
     variation       211
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:937967868"
     variation       212
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:926520518"
     variation       215
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753667174"
     variation       216
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227258150"
     variation       217
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1324189201"
     variation       218
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297039068"
     CDS             220..867
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /note="class A basic helix-loop-helix protein 27;
                     extraembryonic tissues, heart, autonomic nervous system
                     and neural crest derivatives-expressed protein 1"
                     /codon_start=1
                     /product="heart- and neural crest derivatives-expressed
                     protein 1"
                     /protein_id="NP_004812.1"
                     /db_xref="CCDS:CCDS4327.1"
                     /db_xref="GeneID:9421"
                     /db_xref="HGNC:HGNC:4807"
                     /db_xref="MIM:602406"
                     /translation="
MNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ"
     misc_feature    order(502..507,523..531,535..537,604..606,613..615)
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /note="DNA binding region [nucleotide binding]"
                     /db_xref="CDD:238036"
     misc_feature    526..675
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /note="helix loop helix domain; Region: HLH; smart00353"
                     /db_xref="CDD:197674"
     misc_feature    526..528
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /note="E-box/N-box specificity site; other site"
                     /db_xref="CDD:238036"
     misc_feature    538..540
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /note="Phosphothreonine, by PLK4.
                     /evidence=ECO:0000250|UniProtKB:Q64279; propagated from
                     UniProtKB/Swiss-Prot (O96004.1); phosphorylation site"
     misc_feature    544..546
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /note="Phosphoserine, by PLK4.
                     /evidence=ECO:0000250|UniProtKB:Q64279; propagated from
                     UniProtKB/Swiss-Prot (O96004.1); phosphorylation site"
     variation       220
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763806635"
     variation       223
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354473345"
     variation       225
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760607439"
     variation       226
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1299508908"
     variation       228
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775319214"
     variation       229
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767528053"
     variation       231
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167276325"
     variation       232
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1397025136"
     variation       233
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1460357937"
     variation       237
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762997931"
     variation       241
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371033200"
     variation       243
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1321521650"
     variation       244..265
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="caccatcaccacc"
                     /replace="caccatcaccaccatcaccacc"
                     /replace="caccatcaccaccatcaccaccatcaccacc"
                     /db_xref="dbSNP:754696027"
     variation       244
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478174885"
     variation       246
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1257146868"
     variation       253
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:570134327"
     variation       254..257
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="acca"
                     /replace="accaacca"
                     /db_xref="dbSNP:1554105881"
     variation       255
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1347266849"
     variation       256
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769999347"
     variation       257
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1054562820"
     variation       260
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1316132356"
     variation       265
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200556971"
     variation       267
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776997898"
     variation       268
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768925214"
     variation       271
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1333509227"
     variation       275
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747513609"
     variation       276
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1416173325"
     variation       279
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1355879284"
     variation       281
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780396101"
     variation       283
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270137702"
     variation       285..292
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="gctccacg"
                     /replace="gctccacggctccacg"
                     /db_xref="dbSNP:1193545616"
     variation       286
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1389429025"
     variation       289
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1398607391"
     variation       290
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772757234"
     variation       292
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745362462"
     variation       295
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:528298246"
     variation       296
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1261908051"
     variation       300
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163064884"
     variation       306
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:756908501"
     variation       307
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753450334"
     variation       311
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:777581629"
     variation       315
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755831294"
     variation       318
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373192317"
     variation       320
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1253357213"
     variation       326
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199817968"
     variation       329
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:533319519"
     variation       330
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759535790"
     variation       341
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:564241048"
     variation       343
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762046238"
     variation       345
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776751181"
     variation       347
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768965463"
     variation       350
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1297503043"
     variation       351
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145232171"
     variation       352
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1296594232"
     variation       353
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141689288"
     variation       354
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772706064"
     variation       355
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746385291"
     variation       357
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1294461632"
     variation       361
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778513187"
     variation       363
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:770592263"
     variation       364
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1463053457"
     variation       365
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:748866943"
     variation       366
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:912682692"
     variation       367
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1468987419"
     variation       371
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1365842411"
     variation       373
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777266765"
     variation       376
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1454187248"
     variation       377
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251644234"
     variation       378
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:755852180"
     variation       380
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780969396"
     variation       381
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138460675"
     variation       387
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1202928556"
     variation       389
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1346301899"
     variation       390
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1028518076"
     variation       391
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1352583664"
     variation       392
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201496181"
     variation       393
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761768832"
     variation       394
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754000582"
     variation       397
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202045612"
     variation       398
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761028320"
     variation       399
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369386099"
     variation       400
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768012504"
     variation       401
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760076464"
     variation       402
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774965575"
     variation       405
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748732968"
     variation       406
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772843786"
     variation       407
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769262740"
     variation       408
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201149780"
     variation       409
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1196044769"
     variation       413
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1478071174"
     variation       414
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747850568"
     variation       415
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1190602578"
     variation       417
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448334434"
     variation       419
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780916501"
     variation       420
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1582057304"
     variation       421
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374965548"
     variation       423
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746848071"
     variation       424
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1282472466"
     variation       425
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1219669852"
     variation       426
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1307741230"
     variation       427
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:576059307"
     variation       429
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1261595474"
     variation       430
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:758422053"
     variation       432
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:753861203"
     variation       434
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764242373"
     variation       436
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756237060"
     variation       437
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1217088770"
     variation       438
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:6880185"
     variation       444
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:752995620"
     variation       445
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767888040"
     variation       450
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1373952727"
     variation       454
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1176090594"
     variation       456
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1415491664"
     variation       458
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201037401"
     variation       459
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:774910795"
     variation       460
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:766789740"
     variation       461
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763518945"
     variation       462
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263531572"
     variation       464
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772538065"
     variation       465
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198480966"
     variation       466
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201302313"
     variation       469
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1167066563"
     variation       471
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576744103"
     variation       476
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1177737621"
     variation       480
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768347498"
     variation       486
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779893795"
     variation       490
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369296058"
     variation       491
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1320086824"
     variation       498
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201302137"
     variation       499
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777670897"
     variation       500
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1353975436"
     variation       501
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1304914388"
     variation       502
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756183625"
     variation       503
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752869371"
     variation       505
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:572764589"
     variation       508..509
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:753714358"
     variation       508
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:878854746"
     variation       510
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1446547577"
     variation       515
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751904421"
     variation       519
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766779838"
     variation       523
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763319157"
     variation       525
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1419800202"
     variation       526..527
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="ga"
                     /replace="gactga"
                     /db_xref="dbSNP:758433854"
     variation       527
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1182283102"
     variation       529..536
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="cg"
                     /replace="cggagacg"
                     /db_xref="dbSNP:1231168933"
     variation       531
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752927590"
     variation       532
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1480179412"
     variation       533
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765342459"
     variation       534
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759848673"
     variation       538
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1206454242"
     variation       546
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556045294"
     variation       547
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:905545828"
     variation       549
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765703979"
     variation       553
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:761291470"
     variation       555
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776179261"
     variation       558
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150104384"
     variation       561
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:774267927"
     variation       564
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1043638166"
     variation       570
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:536000696"
     variation       572
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1449580591"
     variation       574
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1400422414"
     variation       576
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775093878"
     variation       579
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771928311"
     variation       582
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1396295410"
     variation       583
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1481488405"
     variation       584
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1048063616"
     variation       588
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165033501"
     variation       589
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:745686103"
     variation       593
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405443403"
     variation       594
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430038536"
     variation       597
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778884559"
     variation       598
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1440191810"
     variation       600
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252260773"
     variation       609
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1193145369"
     variation       615
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465345066"
     variation       616
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1467186459"
     variation       618
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1168776644"
     variation       619
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:974646425"
     variation       620
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1222504650"
     variation       623..626
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:765936211"
     variation       627
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1270632355"
     variation       628
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:771047758"
     variation       629
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374536409"
     variation       636
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1407266757"
     variation       637
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755192128"
     variation       638
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1378346540"
     variation       641
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1303293556"
     variation       649
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140560109"
     variation       651
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:570062952"
     variation       653
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1052192853"
     variation       654
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:955676236"
     variation       657
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944492053"
     variation       662
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750803617"
     variation       663
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1452539216"
     variation       664
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1270361699"
     variation       666
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765762725"
     variation       673
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762375465"
     variation       686
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1582056958"
     variation       687
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:34402828"
     variation       690
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:763611267"
     variation       694
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1561711379"
     variation       695
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1191667279"
     variation       698
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:987403652"
     variation       699
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1201471420"
     variation       701
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1269484400"
     variation       703
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192017843"
     variation       706
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1269763181"
     variation       711
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760275585"
     variation       718
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1240546642"
     variation       719
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202139442"
     variation       720
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759358821"
     variation       721
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1327129838"
     variation       726
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774078948"
     variation       729
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1232667164"
     variation       731
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201984942"
     variation       732
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1411946003"
     variation       733
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1166385384"
     variation       736
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1313460396"
     variation       737
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146912397"
     variation       738
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1582056866"
     variation       740
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781370812"
     variation       743
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164568199"
     variation       748
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768888751"
     variation       749
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747099689"
     variation       750
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:34198899"
     exon            763..1701
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /inference="alignment:Splign:2.1.0"
     variation       763
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1333755459"
     variation       768
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779223514"
     variation       770
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1246794989"
     variation       776
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340776953"
     variation       780
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757655487"
     variation       781
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:929460819"
     variation       783
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1561710559"
     variation       784
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389554299"
     variation       785
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147677474"
     variation       787
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778198835"
     variation       788
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756586663"
     variation       795
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752250641"
     variation       798
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1037877952"
     variation       800
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373277337"
     variation       801
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:909108692"
     variation       802
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762914657"
     variation       803..808
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="aga"
                     /replace="agaaga"
                     /db_xref="dbSNP:767079781"
     variation       806
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:878854747"
     variation       814
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:754637839"
     variation       818
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751211164"
     variation       819
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:942295767"
     variation       824
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766161267"
     variation       825
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467632014"
     variation       827
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762786810"
     variation       828
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773154099"
     variation       832
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1439266037"
     variation       833
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:765198552"
     variation       834
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368908340"
     variation       841
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772091154"
     variation       848
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746068193"
     variation       855
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774512591"
     variation       862
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771160670"
     variation       863
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:985784176"
     variation       866
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749591449"
     variation       868
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778180370"
     variation       870
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1407248980"
     variation       871
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756633155"
     variation       873
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1158393202"
     variation       877
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780723638"
     variation       878
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201337632"
     variation       882
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1451098706"
     variation       883
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779794386"
     variation       885
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374569248"
     variation       886
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323026124"
     variation       887
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1582055627"
     variation       888
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370439489"
     variation       889
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750237915"
     variation       890
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1200587792"
     variation       893
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764997341"
     variation       897
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761786357"
     variation       898
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032600927"
     variation       905
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1214248741"
     variation       909
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248488683"
     variation       910
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:979337996"
     variation       911
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753756243"
     variation       914
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376440284"
     variation       915
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1233403496"
     variation       916
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1022951915"
     variation       920
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1012408816"
     variation       936
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1012948443"
     variation       937
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1181239897"
     variation       939
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1362118887"
     variation       948
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1582055572"
     variation       950
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377327099"
     variation       952
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1160091131"
     variation       958
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:894087466"
     variation       960
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1468523981"
     variation       961
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1305148347"
     variation       963
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:993990481"
     variation       968
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:569052472"
     variation       974
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1391301810"
     variation       976
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:186778831"
     variation       980
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1582055552"
     variation       982
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1229860250"
     variation       983
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:999547149"
     variation       1000
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322590887"
     variation       1001
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1202007107"
     variation       1007
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:902481002"
     variation       1010
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1582055538"
     variation       1012
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1257516059"
     variation       1023
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538799782"
     variation       1029
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1195148561"
     variation       1036
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248511959"
     variation       1041
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:933443758"
     variation       1047
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473578011"
     variation       1048
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900585629"
     variation       1054
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889395231"
     variation       1057
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1481664714"
     variation       1058..1065
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="tttttttt"
                     /replace="ttttttttt"
                     /db_xref="dbSNP:1204125612"
     variation       1060
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1479563437"
     variation       1065
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:181136691"
     variation       1071
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375335104"
     variation       1074
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:922934243"
     variation       1077
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139139273"
     variation       1087..1098
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="atatatatat"
                     /replace="atatatatatat"
                     /replace="atatatatatatat"
                     /db_xref="dbSNP:528518569"
     variation       1088
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1411077000"
     variation       1099..1107
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="cca"
                     /replace="ccaccccca"
                     /db_xref="dbSNP:1303221050"
     variation       1102
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925103078"
     variation       1108
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:983744060"
     variation       1109
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1582055495"
     variation       1115
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:928995957"
     variation       1117
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1582055484"
     variation       1121
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203746471"
     variation       1127
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:928329159"
     variation       1132
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:560973762"
     variation       1134..1138
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace=""
                     /replace="caaca"
                     /db_xref="dbSNP:1206012492"
     variation       1136
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484097192"
     variation       1140
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1402965548"
     variation       1141
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1487663438"
     variation       1142..1147
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="aag"
                     /replace="aagaag"
                     /db_xref="dbSNP:779259287"
     variation       1145..1146
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1193135744"
     variation       1151
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298213532"
     variation       1154
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1461210324"
     variation       1162
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1352383683"
     variation       1169
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1023527431"
     variation       1170
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1430928672"
     variation       1173
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1480967436"
     variation       1178
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:969824667"
     variation       1183
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:915647072"
     variation       1184
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189652687"
     variation       1191
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:879098452"
     variation       1196
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1364401049"
     variation       1199
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564072656"
     variation       1201
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:532078892"
     variation       1202
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:992093116"
     variation       1205
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:960028109"
     variation       1208
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765063325"
     variation       1220
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1229039298"
     variation       1228
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1291220324"
     variation       1232
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1197914236"
     variation       1236
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1224070179"
     variation       1240
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1421353342"
     variation       1243
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032605244"
     variation       1244
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993588997"
     variation       1246
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1187121027"
     variation       1247..1253
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="tct"
                     /replace="tctctct"
                     /db_xref="dbSNP:561201958"
     variation       1248
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562993925"
     variation       1250
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1163427495"
     variation       1252
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778026920"
     variation       1257
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1412457236"
     variation       1260
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1195281728"
     variation       1261
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1403044147"
     variation       1270
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1166507278"
     variation       1272
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:962461479"
     variation       1274
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1000150040"
     variation       1280
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016374383"
     variation       1282
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:966982058"
     variation       1288
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1367091808"
     variation       1290
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:889302227"
     variation       1301
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370530933"
     variation       1304
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1265226887"
     variation       1307
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1354360267"
     variation       1312
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:377533464"
     variation       1321
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230063942"
     variation       1325
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759312194"
     variation       1328
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:900616960"
     variation       1329..1332
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace=""
                     /replace="gaga"
                     /db_xref="dbSNP:1207051587"
     variation       1330
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039070588"
     variation       1334..1338
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="agaga"
                     /replace="agagaga"
                     /db_xref="dbSNP:1582055333"
     variation       1335
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270421446"
     variation       1347
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262226873"
     variation       1353
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:998186845"
     variation       1360
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776355630"
     variation       1361
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150779203"
     variation       1362
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1307152063"
     variation       1365
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1390303433"
     variation       1366
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1370817078"
     variation       1371
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:887573276"
     variation       1382
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:576994472"
     variation       1383
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929248860"
     variation       1388
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770719086"
     variation       1390..1403
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="ttttatttt"
                     /replace="ttttattttatttt"
                     /db_xref="dbSNP:1450109719"
     variation       1405
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1174684792"
     variation       1406
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1372614676"
     variation       1409
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:760212975"
     variation       1414
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:928557568"
     variation       1419
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1290390286"
     variation       1443
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045449024"
     variation       1449..1455
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="tct"
                     /replace="tctctct"
                     /db_xref="dbSNP:947847311"
     variation       1457..1461
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="t"
                     /replace="tct"
                     /replace="tctct"
                     /db_xref="dbSNP:377024721"
     variation       1458
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916420729"
     variation       1461
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1276923574"
     variation       1466
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184353195"
     variation       1475
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:960942135"
     variation       1477
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1471945769"
     variation       1478
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1179597083"
     variation       1502
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:928650822"
     variation       1504
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:915678289"
     variation       1508
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1417406451"
     variation       1519
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:35542711"
     variation       1520
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1416106793"
     variation       1526
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1582055254"
     variation       1527
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748150571"
     variation       1528
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:865985564"
     variation       1554
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1408028146"
     variation       1557
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1309895681"
     variation       1558
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1461007565"
     variation       1562
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1223123877"
     variation       1565
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958235944"
     variation       1566
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1273512173"
     variation       1574
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925480267"
     variation       1578
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:953511599"
     variation       1579
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1272863502"
     variation       1583
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1029149496"
     variation       1590
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997773885"
     variation       1599
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202463401"
     variation       1603
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1238163657"
     variation       1604
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1483216458"
     variation       1607..1610
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1197635627"
     variation       1620
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:978274679"
     variation       1630
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:967391458"
     variation       1639
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1375732869"
     variation       1640
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1478858936"
     variation       1641
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1030520460"
     variation       1642
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1173117315"
     variation       1652
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1427715655"
     variation       1660
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310001487"
     variation       1664
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371242846"
     variation       1670
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1582055194"
     variation       1671
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997490118"
     variation       1676
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779103553"
     regulatory      1680..1685
                     /regulatory_class="polyA_signal_sequence"
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /note="hexamer: AATAAA"
     variation       1690
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386432573"
     variation       1693
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1321768335"
     polyA_site      1701
                     /gene="HAND1"
                     /gene_synonym="bHLHa27; eHand; Hxt; Thing1"
                     /note="major polyA site"
ORIGIN      
agaagggttaaacaggtctttgggcttcggcgacctcgcccgcggcagaaaccggtaagaagacagtgggctgcgcgtctcattttcagccttgcccggactctcccaaagccggcgcccagtagtggctccagagcccacaggtggcccccggcagtctctggggcgcatggagcggcgttaatagggctggcggcgcaggccagtagccgctccaacatgaacctcgtgggcagctacgcacaccatcaccaccatcaccacccgcaccctgcgcaccccatgctccacgaacccttcctcttcggtccggcctcgcgctgtcatcaggaaaggccctacttccagagctggctgctgagcccggctgacgctgccccggacttccctgcgggcgggccgccgcccgcggccgctgcagccgccaccgcctatggtcctgacgccaggcctgggcagagccccgggcggctggaggcgcttggcggccgtcttggccggcggaaaggctcaggacccaagaaggagcggagacgcactgagagcattaacagcgcattcgcggagttgcgcgagtgcatccccaacgtgccggccgacaccaagctctccaagatcaagactctgcgcctagccaccagctacatcgcctacctgatggacgtgctggccaaggatgcacagtctggcgatcccgaggccttcaaggctgaactcaagaaggcggatggcggccgtgagagcaagcggaaaagggagctgcagcagcacgaaggttttcctcctgccctgggcccagtcgagaagaggattaaaggacgcaccggctggccgcagcaagtctgggcgctggagttaaaccagtgagccgaggcccgcgccgaggacctggccaggccagccactcctgaagccccgggaggagaggaaggcagcggcgaacgccaggctctgggctccggcgactggtgctacgcatcccgcggagcttctgctgagcgccggcaggtcgtcggctgcaaccacacacttggatcgcacgtgcaatgtcctttgattttttttaatacattaagagaaagagaaatatatatatatccacccccagcccaaccgagggcggcccttggcggcaacatgcaagaaggagggactgtcgaacccaagggctcaaagacgcactcttccacccttttggagcgaatttagaacctcagccctatctccatttccctatctggctctttctctcttgtccctccatatgatccgccccgacgccgtcttctctaattaaaatgcaataaggaatcaattcttttctgcctgagaaagagaaccagacgcaggaagatgaaaggctgccctttgttcttcgaatcgtggtggttttattttatttttctttttgtcgctgcacttcctgtttagttccaagggaaacactttctctctttctctgtctctctcttttcttccttcttttccttcctttttgtttctatctaaataaaagctttccctgtgttggaaagtttttatgtatttaaactacctaccatgcctgttgtgctcaggtgtttgttcatcctgccatccccaacccttttctacctcaagtctgtgtgaccactcacagcccccctcccttcgccaaagcagtgtctatgctcttgattaataaaacattttctgaaatca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]