GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 00:35:59, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_003822               4831 bp    mRNA    linear   PRI 09-JUL-2020
DEFINITION  Homo sapiens nuclear receptor subfamily 5 group A member 2 (NR5A2),
            transcript variant 2, mRNA.
ACCESSION   NM_003822
VERSION     NM_003822.5
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4831)
  AUTHORS   Seitz C, Huang J, Geiselhoringer AL, Galbani-Bianchi P, Michalek S,
            Phan TS, Reinhold C, Dietrich L, Schmidt C, Corazza N, Delgado E,
            Schnalzger T, Schoonjans K and Brunner T.
  TITLE     The orphan nuclear receptor LRH-1/NR5a2 critically regulates T cell
            functions
  JOURNAL   Sci Adv 5 (7), eaav9732 (2019)
   PUBMED   31328159
  REMARK    GeneRIF: This study describes a novel and critical role of LRH-1 in
            T cell maturation, functions, and immopathologies and proposes
            LRH-1 as an emerging pharmacological target in the treatment of T
            cell-mediated inflammatory diseases.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 4831)
  AUTHORS   Yazawa T, Imamichi Y, Sekiguchi T, Miyamoto K, Uwada J, Khan MRI,
            Suzuki N, Umezawa A and Taniguchi T.
  TITLE     Transcriptional Regulation of Ovarian Steroidogenic Genes: Recent
            Findings Obtained from Stem Cell-Derived Steroidogenic Cells
  JOURNAL   Biomed Res Int 2019, 8973076 (2019)
   PUBMED   31058195
  REMARK    GeneRIF: Using the cells derived from the model, novel SF-1/Ad4BP-
            and LRH-1-regulated genes were identified by combined DNA
            microarray and promoter tiling array analyses. The interaction of
            SF-1/Ad4BP and LRH-1 with transcriptional regulators in the
            regulation of ovarian steroidogenesis was also revealed.
            Review article
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 4831)
  AUTHORS   Ye T, Li J, Sun Z, Liu Y, Kong L, Zhou S, Tang J, Wang J and Xing
            HR.
  TITLE     Nr5a2 promotes cancer stem cell properties and tumorigenesis in
            nonsmall cell lung cancer by regulating Nanog
  JOURNAL   Cancer Med 8 (3), 1232-1245 (2019)
   PUBMED   30740909
  REMARK    GeneRIF: we have provided convincing evidence in vitro and in vivo
            demonstrating that Nr5a2 can induce lung CSC properties and promote
            tumorigenesis and progression through transcriptional up-regulation
            of Nanog.
REFERENCE   4  (bases 1 to 4831)
  AUTHORS   Joo MS, Koo JH, Kim TH, Kim YS and Kim SG.
  TITLE     LRH1-driven transcription factor circuitry for hepatocyte identity:
            Super-enhancer cistromic analysis
  JOURNAL   EBioMedicine 40, 488-503 (2019)
   PUBMED   30638865
  REMARK    GeneRIF: study identified LRH1-driven pathway as a circuitry
            responsible for hepatocyte identity by using cistromic analysis,
            improving our understanding of liver pathophysiology and
            identifying novel therapeutic targets.
REFERENCE   5  (bases 1 to 4831)
  AUTHORS   Jin J, Jin J, Woodfield SE, Patel RH, Jin NG, Shi Y, Liu B, Sun W,
            Chen X, Yu Y and Vasudevan SA.
  TITLE     Targeting LRH1 in hepatoblastoma cell lines causes decreased
            proliferation
  JOURNAL   Oncol. Rep. 41 (1), 143-153 (2019)
   PUBMED   30320362
  REMARK    GeneRIF: Results found the mRNA and protein expression levels of
            LRH1 were significantly higher in HepG2 and HuH6 hepatoblastoma
            cell lines and results suggest that LRH1 may contribute to cell
            proliferation in hepatoblastoma. Hepatoblastoma cells with higher
            LRH1 expression levels more susceptible to LRH1 inhibition.
REFERENCE   6  (bases 1 to 4831)
  AUTHORS   Nitta M, Ku S, Brown C, Okamoto AY and Shan B.
  TITLE     CPF: an orphan nuclear receptor that regulates liver-specific
            expression of the human cholesterol 7alpha-hydroxylase gene
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 96 (12), 6660-6665 (1999)
   PUBMED   10359768
REFERENCE   7  (bases 1 to 4831)
  AUTHORS   Li M, Xie YH, Kong YY, Wu X, Zhu L and Wang Y.
  TITLE     Cloning and characterization of a novel human hepatocyte
            transcription factor, hB1F, which binds and activates enhancer II
            of hepatitis B virus
  JOURNAL   J. Biol. Chem. 273 (44), 29022-29031 (1998)
   PUBMED   9786908
REFERENCE   8  (bases 1 to 4831)
  AUTHORS   Galarneau L, Drouin R and Belanger L.
  TITLE     Assignment of the fetoprotein transcription factor gene (FTF) to
            human chromosome band 1q32.11 by in situ hybridization
  JOURNAL   Cytogenet. Cell Genet. 82 (3-4), 269-270 (1998)
   PUBMED   9858833
REFERENCE   9  (bases 1 to 4831)
  AUTHORS   Wong M, Ramayya MS, Chrousos GP, Driggers PH and Parker KL.
  TITLE     Cloning and sequence analysis of the human gene encoding
            steroidogenic factor 1
  JOURNAL   J. Mol. Endocrinol. 17 (2), 139-147 (1996)
   PUBMED   8938589
REFERENCE   10 (bases 1 to 4831)
  AUTHORS   Bernier D, Thomassin H, Allard D, Guertin M, Hamel D, Blaquiere M,
            Beauchemin M, LaRue H, Estable-Puig M and Belanger L.
  TITLE     Functional analysis of developmentally regulated
            chromatin-hypersensitive domains carrying the alpha 1-fetoprotein
            gene promoter and the albumin/alpha 1-fetoprotein intergenic
            enhancer
  JOURNAL   Mol. Cell. Biol. 13 (3), 1619-1633 (1993)
   PUBMED   7680097
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF146343.1, AC096633.2 and
            CA776772.1.
            On May 31, 2019 this sequence version replaced NM_003822.4.
            
            Summary: The protein encoded by this gene is a DNA-binding zinc
            finger transcription factor and is a member of the fushi tarazu
            factor-1 subfamily of orphan nuclear receptors. The encoded protein
            is involved in the expression of genes for hepatitis B virus and
            cholesterol biosynthesis, and may be an important regulator of
            embryonic development. [provided by RefSeq, Jun 2016].
            
            Transcript Variant: This variant (2) lacks an alternate in-frame
            exon compared to variant 1. The resulting isoform (2) has the same
            N- and C-termini but is shorter compared to isoform 1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC118571.1, AF146343.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1968540, SAMEA2142348
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1729              AF146343.1         70-1798
            1730-4625           AC096633.2         8383-11278          c
            4626-4831           CA776772.1         18-223              c
FEATURES             Location/Qualifiers
     source          1..4831
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q32.1"
     gene            1..4831
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /note="nuclear receptor subfamily 5 group A member 2"
                     /db_xref="GeneID:2494"
                     /db_xref="HGNC:HGNC:7984"
                     /db_xref="MIM:604453"
     exon            1..202
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1250378338"
     variation       2
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1471419777"
     variation       8
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1178627313"
     variation       9
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:547344483"
     variation       11
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:899053936"
     variation       14
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1157268252"
     variation       21
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1456943974"
     variation       27
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412914367"
     variation       29
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1184458308"
     variation       31
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993750317"
     variation       43
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763695678"
     variation       52
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:865999887"
     variation       55
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:890269202"
     variation       56
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1401720427"
     variation       57
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:773794934"
     variation       59
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141983892"
     variation       60
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:562340283"
     variation       76
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1229774373"
     variation       78
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:964040584"
     variation       81
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:996813802"
     variation       89
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770447741"
     variation       93
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781510953"
     variation       94
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374712916"
     variation       104
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381207031"
     misc_feature    106..108
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /note="upstream in-frame stop codon"
     variation       115
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1163431218"
     variation       117
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11582055"
     variation       118
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1318321684"
     variation       126
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775149014"
     variation       127
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755926901"
     variation       130
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1172815645"
     variation       133
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369076701"
     variation       134
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763475263"
     CDS             139..1626
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /note="isoform 2 is encoded by transcript variant 2; CYP7A
                     promoter-binding factor; fetoprotein-alpha 1 (AFP)
                     transcription factor; b1-binding factor, hepatocyte
                     transcription factor which activates enhancer II of
                     hepatitis B virus; liver nuclear receptor homolog-1
                     variant 2; hepatocytic transcription factor hB1F-3"
                     /codon_start=1
                     /product="nuclear receptor subfamily 5 group A member 2
                     isoform 2"
                     /protein_id="NP_003813.1"
                     /db_xref="CCDS:CCDS1400.1"
                     /db_xref="GeneID:2494"
                     /db_xref="HGNC:HGNC:7984"
                     /db_xref="MIM:604453"
                     /translation="
MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA"
     misc_feature    256..534
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /note="The DNA-binding domain of Lrh-1 like nuclear
                     receptor family like is composed of two C4-type zinc
                     fingers; Region: NR_DBD_Lrh-1_like; cd07167"
                     /db_xref="CDD:143541"
     misc_feature    order(256..258,265..267,307..309,316..318,364..366,
                     382..384,412..414,421..423)
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:143541"
     misc_feature    order(286..294,310..315,319..321,325..327,331..336,
                     343..345,403..408,424..426,463..471,478..498,514..516)
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143541"
     misc_feature    901..1623
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /note="The ligand binding domain of the liver receptor
                     homolog-1, a member of nuclear receptor superfamily;
                     Region: NR_LBD_Lrh-1; cd07069"
                     /db_xref="CDD:132754"
     misc_feature    order(997..1014,1018..1026,1255..1257,1558..1566,
                     1570..1578,1582..1587)
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:132754"
     misc_feature    order(1024..1026,1033..1038,1144..1149,1156..1158,
                     1168..1170,1213..1215,1246..1248,1255..1263,1270..1272,
                     1279..1284,1537..1539,1546..1551,1558..1560)
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:132754"
     misc_feature    order(1060..1062,1069..1071,1081..1083,1111..1113,
                     1120..1125,1132..1137,1588..1593,1600..1605)
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /note="corepressor recognition site; other site"
                     /db_xref="CDD:132754"
     variation       144
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1456506795"
     variation       163
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:894436987"
     variation       166
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:61755053"
     variation       172
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:958288378"
     variation       175
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1024315283"
     variation       176
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1188340185"
     variation       186
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143373151"
     variation       187
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377057930"
     variation       194
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548070488"
     variation       196
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142187332"
     variation       199
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759506185"
     variation       200
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765156524"
     exon            203..321
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /inference="alignment:Splign:2.1.0"
     variation       204
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759615030"
     variation       207
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1203358545"
     variation       208
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:765621229"
     variation       210
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:896985969"
     variation       216
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571705500"
     variation       217
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752758558"
     variation       218
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571705509"
     variation       222
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763134222"
     variation       224
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1250865105"
     variation       229
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:767509468"
     variation       231
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1179472709"
     variation       233
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750415576"
     variation       234
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756044305"
     variation       236
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1165570721"
     variation       237
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:566192787"
     variation       252
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461321655"
     variation       253
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1324332775"
     variation       261
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753645735"
     variation       263
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448593920"
     variation       264
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201645640"
     variation       270
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:553657867"
     variation       273
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1236234751"
     variation       274
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:149536740"
     variation       280
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1457202210"
     variation       282
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771602498"
     variation       285
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1187644944"
     variation       288
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1212938984"
     variation       291..292
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:748637958"
     variation       294
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375484896"
     variation       297
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1458904303"
     variation       299..300
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:1259374514"
     variation       300
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:144195644"
     variation       303
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250070671"
     variation       306
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771398338"
     exon            322..463
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /inference="alignment:Splign:2.1.0"
     variation       324
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752316788"
     variation       333
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34231860"
     variation       342
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1426393408"
     variation       354
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1429566185"
     variation       360
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558101541"
     variation       363
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1314047804"
     variation       366
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571708035"
     variation       367
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1032210572"
     variation       368
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:547053833"
     variation       376
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:868318116"
     variation       382
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1481006455"
     variation       397
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995472299"
     variation       398
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777249920"
     variation       402
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746566364"
     variation       408
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757714638"
     variation       410
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781564092"
     variation       417
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033683398"
     variation       425
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746191281"
     variation       443
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770310095"
     variation       444
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:776035131"
     variation       449
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:568473881"
     variation       457
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749497081"
     variation       458
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769068786"
     exon            464..1110
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /inference="alignment:Splign:2.1.0"
     variation       466
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759459779"
     variation       471
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1170390048"
     variation       474
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151039307"
     variation       475
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373723203"
     variation       478
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:573680652"
     variation       479
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762746404"
     variation       482
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202168201"
     variation       484
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763749694"
     variation       485
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751202522"
     variation       487
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749906411"
     variation       490
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:960375609"
     variation       492
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:761565865"
     variation       495
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766913377"
     variation       510
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767220881"
     variation       521
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:987775691"
     variation       525
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750009121"
     variation       528
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571712152"
     variation       532
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1439034158"
     variation       533
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558103553"
     variation       543
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195448284"
     variation       550
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1034925236"
     variation       552
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1311738356"
     variation       553
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:897472603"
     variation       556
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:756624487"
     variation       557
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:960839176"
     variation       559
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:987961515"
     variation       560
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376606471"
     variation       561
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304883072"
     variation       573
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1276777334"
     variation       576
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:556789514"
     variation       579
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779378493"
     variation       583
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1348712017"
     variation       586
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1273007518"
     variation       587
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571712291"
     variation       593
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748299766"
     variation       600
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1467389931"
     variation       607
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772398661"
     variation       612
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1234240659"
     variation       615
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777713696"
     variation       623
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1238658351"
     variation       627
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:747093006"
     variation       629
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1280566946"
     variation       635
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571712359"
     variation       638
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1444832096"
     variation       641
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:769658948"
     variation       644
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571712387"
     variation       645
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:367553497"
     variation       650
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1476159045"
     variation       651
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165533803"
     variation       653
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775424771"
     variation       654
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762696952"
     variation       657
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768303959"
     variation       669
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:578158497"
     variation       670
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761356027"
     variation       678
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:545151830"
     variation       681
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749896579"
     variation       682
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1407176293"
     variation       691
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1156491797"
     variation       695
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381405292"
     variation       697
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1159004399"
     variation       706
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766953218"
     variation       707
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370765271"
     variation       708
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140704739"
     variation       709
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779135801"
     variation       715
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753174754"
     variation       716
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558103859"
     variation       723
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:777981641"
     variation       725
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747037821"
     variation       728
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230726634"
     variation       729
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757354643"
     variation       730
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201522628"
     variation       731
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749157454"
     variation       735
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968164925"
     variation       737
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200947591"
     variation       743
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372532536"
     variation       746
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419909946"
     variation       747
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1409662491"
     variation       748
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1168568776"
     variation       749
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1377419680"
     variation       750
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2821368"
     variation       756
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370987975"
     variation       757
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776342501"
     variation       759
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:765781140"
     variation       761
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:752945055"
     variation       762
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758810789"
     variation       765
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764257662"
     variation       767
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270429680"
     variation       770
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757522943"
     variation       780..783
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="at"
                     /replace="atat"
                     /db_xref="dbSNP:1413834578"
     variation       780
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1355678791"
     variation       781
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781233871"
     variation       788
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:887858624"
     variation       789
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746025193"
     variation       792
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373837022"
     variation       793
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778933557"
     variation       796
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1242534374"
     variation       799
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747857889"
     variation       800
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201214610"
     variation       801
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1228074346"
     variation       802
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746650608"
     variation       803
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:770777886"
     variation       804
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374594498"
     variation       805
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776217485"
     variation       810
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1191694862"
     variation       816
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191599647"
     variation       827
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1242730786"
     variation       833
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765609869"
     variation       840
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1558104181"
     variation       843
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776091744"
     variation       844
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201990828"
     variation       848
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763405171"
     variation       852
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868237127"
     variation       853
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142863458"
     variation       854
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:549704205"
     variation       857
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757464845"
     variation       861
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767729564"
     variation       863
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1234504519"
     variation       864
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036053183"
     variation       866
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750422848"
     variation       869
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1342217183"
     variation       870
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1206892881"
     variation       881
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:756250928"
     variation       882
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1446300572"
     variation       884
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139624279"
     variation       885
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752657807"
     variation       889
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1454889391"
     variation       902
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1193219004"
     variation       906
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1255367223"
     variation       907
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:532362884"
     variation       910
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777710720"
     variation       911
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1432885604"
     variation       913
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1159161761"
     variation       918
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867130959"
     variation       926
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746807933"
     variation       931
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:770653281"
     variation       940
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780916114"
     variation       943
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484680700"
     variation       945
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1325075033"
     variation       946
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:745326903"
     variation       956
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:769312861"
     variation       957
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774908080"
     variation       961
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763436139"
     variation       962
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:769216513"
     variation       963
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774630894"
     variation       967
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762189252"
     variation       974
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767688677"
     variation       979
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1206691380"
     variation       982
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200093294"
     variation       984
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760856582"
     variation       985
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1213376252"
     variation       991
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1251361210"
     variation       996
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1471971824"
     variation       997
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:766472339"
     variation       998
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61755054"
     variation       1005
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477047282"
     variation       1006
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777870204"
     variation       1008
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751348254"
     variation       1009
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368332488"
     variation       1011
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142287973"
     variation       1023
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769389370"
     variation       1025
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201550930"
     variation       1028
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756542971"
     variation       1029
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1392735185"
     variation       1033
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748799801"
     variation       1034
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1215831071"
     variation       1036
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1334640443"
     variation       1038
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769091935"
     variation       1043
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1295049627"
     variation       1044
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1177311683"
     variation       1052
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:774872040"
     variation       1056
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1021502854"
     variation       1063
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1232461495"
     variation       1065
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1263413647"
     variation       1066
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:762348879"
     variation       1067
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1196579669"
     variation       1068
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:904337593"
     variation       1071
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772460047"
     variation       1072
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1482110974"
     variation       1073
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:913607008"
     variation       1080
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1329011437"
     variation       1089
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1031516851"
     variation       1090
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355326021"
     variation       1099
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172714024"
     exon            1111..1230
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /inference="alignment:Splign:2.1.0"
     variation       1113
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758886632"
     variation       1114
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1403852059"
     variation       1116
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1321023521"
     variation       1118
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571496389"
     variation       1119
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778168529"
     variation       1129
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747362974"
     variation       1132
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1409298590"
     variation       1140
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:936220213"
     variation       1143
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771165664"
     variation       1149
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367908013"
     variation       1161
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765360957"
     variation       1162
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752064904"
     variation       1164
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757729465"
     variation       1165
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775644685"
     variation       1167
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1428618356"
     variation       1169
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1226327686"
     variation       1171
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781698898"
     variation       1177
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201357988"
     variation       1178
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772993318"
     variation       1180
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571496557"
     variation       1182
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760717541"
     variation       1183
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474291454"
     variation       1185
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766148640"
     variation       1186
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558145637"
     variation       1187
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1188529154"
     variation       1188
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:753700509"
     variation       1189
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571496622"
     variation       1190..1201
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="atggaaaggaag"
                     /replace="atggaaaggaagatggaaaggaag"
                     /db_xref="dbSNP:753276049"
     variation       1193
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759125008"
     variation       1194
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764887244"
     variation       1200
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752204054"
     variation       1201
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757881323"
     variation       1203
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1285821360"
     variation       1205
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867291909"
     variation       1213
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1444358975"
     variation       1214
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1377333745"
     variation       1218
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435934062"
     variation       1221
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1257930265"
     variation       1222..1223
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1334081560"
     variation       1223
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357848733"
     variation       1224
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1433344203"
     variation       1225
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1271070216"
     variation       1226
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777379743"
     variation       1227
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1227152290"
     variation       1228
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751984795"
     variation       1230
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:372177139"
     exon            1231..1378
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /inference="alignment:Splign:2.1.0"
     variation       1233
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1271842156"
     variation       1234
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:781767605"
     variation       1236
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1403096471"
     variation       1242
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756577576"
     variation       1243
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1198289563"
     variation       1245
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1344805465"
     variation       1246
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:748764541"
     variation       1249
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1375953011"
     variation       1259
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780604273"
     variation       1260
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372651488"
     variation       1266
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1411762345"
     variation       1268
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1455985851"
     variation       1269
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:965474298"
     variation       1273
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1167466731"
     variation       1278
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377308692"
     variation       1283
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386938053"
     variation       1284
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778793999"
     variation       1287
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766446466"
     variation       1292
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369542811"
     variation       1293
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1444377177"
     variation       1298
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:539027854"
     variation       1301
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770809230"
     variation       1303
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776585291"
     variation       1304
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146778765"
     variation       1306
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769550871"
     variation       1307
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:951188707"
     variation       1308
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775408975"
     variation       1309
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1209444551"
     variation       1310
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1265408960"
     variation       1315
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:762506535"
     variation       1316
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1182541887"
     variation       1321
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251735242"
     variation       1326
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1471873522"
     variation       1328
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1359620108"
     variation       1332
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763804798"
     variation       1337
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773676381"
     variation       1338
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761428455"
     variation       1339
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1162282318"
     variation       1344
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768098245"
     variation       1345
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750928806"
     variation       1347
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146607552"
     variation       1353
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766648764"
     variation       1354
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199871331"
     variation       1356
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754235719"
     variation       1359
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200672188"
     variation       1360
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1294957180"
     variation       1370
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:755099462"
     exon            1379..4831
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /inference="alignment:Splign:2.1.0"
     variation       1379
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1199130844"
     variation       1380
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1264241845"
     variation       1381
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1466013205"
     variation       1382
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761198995"
     variation       1384
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1389090923"
     variation       1385
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482252196"
     variation       1390
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1447144880"
     variation       1393
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1174901066"
     variation       1400
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571594833"
     variation       1404
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766924985"
     variation       1416
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754105342"
     variation       1419
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:202153830"
     variation       1425
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1386825200"
     variation       1427
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363395941"
     variation       1433
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765564537"
     variation       1435
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1286138099"
     variation       1436..1437
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:778425009"
     variation       1436
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752897392"
     variation       1437
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150243341"
     variation       1438
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747092960"
     variation       1452
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1049925447"
     variation       1456
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1303902307"
     variation       1458
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:932350625"
     variation       1459
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1425565369"
     variation       1464
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:149054125"
     variation       1466
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571595003"
     variation       1469
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183953069"
     variation       1470
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748994632"
     variation       1476
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465628274"
     variation       1478
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1473041723"
     variation       1480
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1389576054"
     variation       1482
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768466796"
     variation       1484
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1247035651"
     variation       1487
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:946976621"
     variation       1503
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143039367"
     variation       1505
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747798997"
     variation       1512
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771855360"
     variation       1513
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1050922837"
     variation       1515
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147419125"
     variation       1516
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1255470556"
     variation       1518
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:565841747"
     variation       1519
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1200954942"
     variation       1520
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771306384"
     variation       1531
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777167598"
     variation       1532
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1158063982"
     variation       1536
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760015255"
     variation       1542
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1386772005"
     variation       1543
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4255412"
     variation       1548
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765625573"
     variation       1549
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1294245752"
     variation       1553
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1366961248"
     variation       1555
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1327806094"
     variation       1562
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1385660607"
     variation       1563
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1015956920"
     variation       1564
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1330342569"
     variation       1568
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373453960"
     variation       1569
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1060060"
     variation       1570
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995931179"
     variation       1572
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764311097"
     variation       1573
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751586641"
     variation       1576
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1487863979"
     variation       1580
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1188887185"
     variation       1581
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757388795"
     variation       1582
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781167513"
     variation       1596
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139798381"
     variation       1598
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376108677"
     variation       1603
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:778784980"
     variation       1609
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165745711"
     variation       1614
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1349431099"
     variation       1619
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75501086"
     variation       1622
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1391169897"
     variation       1623
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747971102"
     variation       1625..1626
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:1309886705"
     variation       1627
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771802302"
     variation       1629
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1409727210"
     variation       1631
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1286888220"
     variation       1634..1637
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:754332856"
     variation       1634
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1229729513"
     variation       1635
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777602579"
     variation       1642
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746682987"
     variation       1643
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:770456719"
     variation       1646
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1187442821"
     variation       1649
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1276096418"
     variation       1653
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1483372283"
     variation       1654
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760079892"
     variation       1655
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1269701334"
     variation       1658
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1249433699"
     variation       1663
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377340850"
     variation       1668
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370677122"
     variation       1669
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1413382146"
     variation       1671
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1344445118"
     variation       1672
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:992239683"
     variation       1676
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249879524"
     variation       1677
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436326543"
     variation       1678..1681
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:757657182"
     variation       1678
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763328155"
     variation       1681
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1247384193"
     variation       1683
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866343588"
     variation       1684
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363669018"
     variation       1687..1695
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="gaagaa"
                     /replace="gaagaagaa"
                     /db_xref="dbSNP:1023453606"
     variation       1687
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1025013802"
     variation       1694
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:966875200"
     variation       1696
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1367428964"
     variation       1698
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187662223"
     variation       1699
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1553282280"
     variation       1701
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:537191680"
     variation       1702
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484521397"
     variation       1703
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1182994951"
     variation       1712
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192579356"
     variation       1723
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459230981"
     variation       1725
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1264111557"
     variation       1729
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576777421"
     variation       1730
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1060061"
     variation       1732
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249360378"
     variation       1733
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543874380"
     variation       1734
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:868753440"
     variation       1739..1740
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1434123149"
     variation       1746
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571595751"
     variation       1749
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:866274476"
     variation       1751
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:953092035"
     variation       1757
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1340437975"
     variation       1768
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:986314754"
     variation       1773
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1229808810"
     variation       1777..1784
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ataataat"
                     /replace="ataataataat"
                     /db_xref="dbSNP:911365750"
     variation       1779
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:946893494"
     variation       1782
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1435789878"
     variation       1784
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:932296905"
     variation       1794
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1325741257"
     variation       1799
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1050869159"
     variation       1801
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1406612345"
     variation       1811
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554148554"
     variation       1813
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297560280"
     variation       1816
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746081498"
     variation       1817
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1392919106"
     variation       1819
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571595892"
     variation       1828
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1043945798"
     variation       1841
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1430338180"
     variation       1844..1846
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:764395661"
     variation       1848
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:924203896"
     variation       1853
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1170316907"
     variation       1854
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182552712"
     variation       1875..1878
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="aa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1377881449"
     variation       1880
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1200536291"
     variation       1883
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1201995314"
     variation       1885
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1056371499"
     variation       1894..1900
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="tg"
                     /replace="tggattg"
                     /db_xref="dbSNP:1251555394"
     variation       1895
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116603498"
     variation       1896
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1484336188"
     variation       1900
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1277095435"
     variation       1902
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218764609"
     variation       1906
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995402165"
     variation       1911
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1232846009"
     variation       1916
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779843510"
     variation       1918
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1255650263"
     variation       1920
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045572970"
     variation       1923
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769182489"
     variation       1924
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1055446685"
     variation       1928
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1307215614"
     variation       1938
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:895192152"
     variation       1939
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1013523758"
     variation       1947
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:561192271"
     variation       1948
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:531645020"
     variation       1952
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571596073"
     variation       1953
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1000118987"
     variation       1954
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1032470876"
     variation       1955
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780120680"
     variation       1971
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1471344731"
     variation       1973
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1236307297"
     variation       1984..1986
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1169574498"
     variation       1990
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374542267"
     variation       1993
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571596116"
     variation       1994
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1210011719"
     variation       2001
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1352697706"
     variation       2003
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1060062"
     variation       2005
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749349138"
     variation       2007
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1206857083"
     variation       2011
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1029991054"
     variation       2021
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:922173992"
     variation       2022
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562141771"
     variation       2023
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377747524"
     variation       2026
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1438236027"
     variation       2040
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1305209822"
     variation       2042
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:536706732"
     variation       2046
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1021797009"
     variation       2060
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1455166816"
     variation       2083
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1387505343"
     variation       2085
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1159441023"
     variation       2091
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1402869216"
     variation       2092
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:953715717"
     variation       2097
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571596261"
     variation       2098
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412091279"
     variation       2104
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:986437250"
     variation       2105
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1272853909"
     variation       2113
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:912334610"
     variation       2116
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:939713004"
     variation       2126
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186810720"
     variation       2129..2132
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1464474445"
     variation       2129
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1269082553"
     variation       2131
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543521602"
     variation       2132
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2690034"
     variation       2138
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1287508350"
     variation       2144
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:924133688"
     variation       2154
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1259082598"
     variation       2155
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379867807"
     variation       2166
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1317042043"
     variation       2169
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432347419"
     variation       2170
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1363816324"
     variation       2187
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:935572343"
     variation       2188..2195
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="cccagtgg"
                     /db_xref="dbSNP:1468335790"
     variation       2193
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:992382212"
     variation       2202
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:917891716"
     variation       2210
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1347710879"
     variation       2224..2227
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:750442156"
     variation       2229
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1478361522"
     variation       2234
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1387678310"
     variation       2242
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:532426528"
     variation       2246
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185986679"
     variation       2259
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448999743"
     variation       2261
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248730662"
     variation       2264
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:931139945"
     variation       2271..2275
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ta"
                     /replace="tatta"
                     /db_xref="dbSNP:1487641600"
     variation       2278
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948049154"
     variation       2285
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220611927"
     variation       2293
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:547801587"
     variation       2295
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:887849783"
     variation       2298
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138094913"
     variation       2309
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1013551504"
     variation       2315
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1046357390"
     variation       2321
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1215761326"
     variation       2323
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558184773"
     variation       2324
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1365104812"
     variation       2325
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:942169192"
     variation       2331
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437713277"
     variation       2334
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373827638"
     variation       2342
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459710833"
     variation       2349
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1325038909"
     variation       2353
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:530044898"
     variation       2365
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1306495531"
     variation       2376..2384
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ttaat"
                     /replace="ttaattaat"
                     /db_xref="dbSNP:1036180385"
     variation       2377
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2816912"
     variation       2385
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1267895003"
     variation       2391
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866562256"
     variation       2400
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032832896"
     variation       2409
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:796711514"
     variation       2410
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1172686646"
     variation       2411..2413
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1571596644"
     variation       2411
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1431480240"
     variation       2421
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1424812729"
     variation       2426
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1191982982"
     variation       2428
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569870620"
     variation       2430
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781588811"
     variation       2435
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958270223"
     variation       2440
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1220945196"
     variation       2445
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1279418319"
     variation       2450
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:997407536"
     variation       2471
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:996729603"
     variation       2475
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1334530808"
     variation       2482
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1212220170"
     variation       2485
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762354867"
     variation       2496
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1029276601"
     variation       2497
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:772413461"
     variation       2498
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187189958"
     variation       2501
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1215384332"
     variation       2502
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1223760753"
     variation       2503
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1346963770"
     variation       2504
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1286872961"
     variation       2508
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772236707"
     variation       2513
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571596772"
     variation       2521
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773506551"
     variation       2524
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:954918685"
     variation       2527
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:986468527"
     variation       2531
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371757960"
     variation       2534
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1300417528"
     variation       2537
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773634748"
     variation       2543
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1030272404"
     variation       2547
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1176803210"
     variation       2552
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1481558416"
     variation       2555
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:961326413"
     variation       2571
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1489325936"
     variation       2575
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1409964130"
     variation       2578
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:888748864"
     variation       2580
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1417085578"
     variation       2585
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472122332"
     variation       2587
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149528752"
     variation       2594
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1021326437"
     variation       2605
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764810866"
     variation       2607
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254906180"
     variation       2615
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:752205875"
     variation       2623
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:977225933"
     variation       2626
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265816450"
     variation       2638
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1228237729"
     variation       2642
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414348414"
     variation       2643
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762404637"
     variation       2650
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1031100003"
     variation       2652
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1399728719"
     variation       2674
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:931192804"
     variation       2679
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1470982168"
     variation       2680
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763702770"
     variation       2685
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147213131"
     variation       2692
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571596963"
     variation       2694
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1400081667"
     variation       2705
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1299277698"
     variation       2714
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1364175787"
     variation       2717
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1183630405"
     variation       2721
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1355369577"
     variation       2722
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1243336804"
     variation       2730
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1422012065"
     variation       2731
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:916514277"
     variation       2732
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370541508"
     variation       2735
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1183714013"
     variation       2738
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751524015"
     variation       2744
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1245881685"
     variation       2747
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1207732620"
     variation       2748
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558185083"
     variation       2757..2758
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:1350860381"
     variation       2757
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1262902263"
     variation       2773
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1046388030"
     variation       2775
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1282461676"
     variation       2794..2797
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:35324783"
     variation       2794
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373492932"
     variation       2795
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:902556633"
     variation       2798..2800
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1355862244"
     variation       2798
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:534307122"
     variation       2801
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1053897014"
     variation       2804
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1454707131"
     variation       2813
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191651222"
     variation       2816
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:572643464"
     variation       2824
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571597125"
     variation       2826
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1382993375"
     variation       2828
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1387361488"
     variation       2836
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:536549789"
     variation       2841
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256980254"
     variation       2845
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160136297"
     variation       2848
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1456172006"
     variation       2861
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1367890410"
     variation       2864
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484649816"
     variation       2866
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571597175"
     variation       2867
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184465305"
     variation       2881
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1237817787"
     variation       2883
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:554700962"
     variation       2884
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1009187299"
     variation       2892..2917
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ttcaaatgactattatcagtattatt"
                     /replace="ttcaaatgactattatcagtattatttcaaatgactattatcagtatt
                     att"
                     /db_xref="dbSNP:1156378558"
     variation       2892
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1571597212"
     variation       2902
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1381790000"
     variation       2906
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:905538265"
     variation       2907
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1036463392"
     variation       2924
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1015183949"
     variation       2925
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:897638267"
     variation       2927
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:961097402"
     variation       2929
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:576247779"
     variation       2930
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1297003355"
     variation       2931
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:77733147"
     variation       2933
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:75978416"
     variation       2934
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77780425"
     variation       2943
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781064293"
     variation       2949
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1172470215"
     variation       2950
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750252400"
     variation       2951..2956
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ttattt"
                     /replace="ttatttattt"
                     /db_xref="dbSNP:1373133821"
     variation       2955
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1051648922"
     variation       2971
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1321825246"
     variation       2974
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1394777257"
     variation       2979
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1384921976"
     variation       2985
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1336741692"
     variation       2989
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:543485158"
     variation       2993
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:990614152"
     variation       3002..3010
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="taaa"
                     /replace="taaaataaa"
                     /db_xref="dbSNP:1303467546"
     variation       3003
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1441941525"
     variation       3010
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1426510125"
     variation       3011
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1388197363"
     variation       3013
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1307280373"
     variation       3039
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190165930"
     variation       3040
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916378825"
     variation       3047
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1241239244"
     variation       3048
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:949212791"
     variation       3049
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1270055409"
     variation       3050
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:193121543"
     variation       3051
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1007498051"
     variation       3057
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:982033620"
     variation       3062
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1482372772"
     variation       3072..3076
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1274513908"
     variation       3075
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196527330"
     variation       3076
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345883075"
     variation       3079
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273093692"
     variation       3080
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1232819118"
     variation       3086
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:923835490"
     variation       3104
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:564368453"
     variation       3105
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:998537535"
     variation       3106
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1031383864"
     variation       3107
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:185551966"
     variation       3113
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:956834189"
     variation       3119
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1054166864"
     variation       3134
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:541058384"
     variation       3136
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:16846237"
     variation       3140..3148
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="tta"
                     /replace="ttattttta"
                     /db_xref="dbSNP:1170224233"
     variation       3145
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116175107"
     variation       3163
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:780170356"
     variation       3165
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749563312"
     variation       3167
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1239849765"
     variation       3171
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548514376"
     variation       3172
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:563444273"
     variation       3178
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251803523"
     variation       3179
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:530701135"
     variation       3183..3190
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="aaa"
                     /replace="aaatcaaa"
                     /db_xref="dbSNP:970028534"
     variation       3184
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:890667215"
     variation       3193
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1009053023"
     variation       3194
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467163722"
     variation       3195
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1174758738"
     variation       3196
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1403556531"
     variation       3199
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1015216466"
     variation       3208
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1225183683"
     variation       3211..3213
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="t"
                     /replace="ttt"
                     /db_xref="dbSNP:1348376138"
     variation       3212
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1278673873"
     variation       3215
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571597711"
     variation       3224
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1442843423"
     variation       3231..3237
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="cggcggc"
                     /replace="cggcggcggc"
                     /db_xref="dbSNP:1337420169"
     variation       3231
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:189212492"
     variation       3232
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993865365"
     variation       3234
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027025316"
     variation       3235
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:879137918"
     variation       3237
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571597769"
     variation       3239
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1455264956"
     variation       3241
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:990561591"
     variation       3244
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1023338030"
     variation       3245
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:970558618"
     variation       3249
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:919349416"
     variation       3257
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1159473593"
     variation       3260..3265
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /db_xref="dbSNP:1471457069"
     variation       3267
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1236210913"
     variation       3271
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1302983040"
     variation       3271
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:933427507"
     variation       3275
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1051595580"
     variation       3279
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1245258361"
     variation       3281..3285
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="gtccc"
                     /db_xref="dbSNP:1207069219"
     variation       3285
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:981896189"
     variation       3286..3291
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="tt"
                     /replace="ttaatt"
                     /db_xref="dbSNP:1558185668"
     variation       3292
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:552436184"
     variation       3300
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:923892331"
     variation       3311
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:956792618"
     variation       3317
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:570442804"
     variation       3318..3325
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="gta"
                     /replace="gtagtgta"
                     /db_xref="dbSNP:1352808811"
     variation       3325
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1235525437"
     variation       3334
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769666099"
     variation       3342
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1451357249"
     variation       3345
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73073303"
     variation       3347
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:915262320"
     variation       3349
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:943252009"
     variation       3350
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868704315"
     variation       3354
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1042996665"
     variation       3357
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344193026"
     variation       3359
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:546229910"
     variation       3376
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:568055522"
     variation       3378
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:768594316"
     variation       3379
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1412346738"
     variation       3386
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1445703650"
     variation       3393
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:998482051"
     variation       3398
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1458063297"
     variation       3404
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1052751768"
     variation       3405
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1571598016"
     variation       3407
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1250760390"
     variation       3413
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1050525203"
     variation       3414
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779024458"
     variation       3424
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:911968111"
     variation       3432
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775405839"
     variation       3445
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1448506595"
     variation       3449
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1287398618"
     variation       3450
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:180686605"
     variation       3451
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:898077122"
     variation       3466
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554866688"
     variation       3478
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1002847769"
     variation       3481
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995461798"
     variation       3484
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1289085952"
     variation       3488..3489
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1558185806"
     variation       3489
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1049309036"
     variation       3496
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1402851602"
     variation       3499
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1433395865"
     variation       3509
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373925354"
     variation       3510
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:888147702"
     variation       3511
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1011848516"
     variation       3513
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1348510548"
     variation       3518
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185294707"
     variation       3528
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:188832676"
     variation       3531
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016519365"
     variation       3537
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1367948547"
     variation       3543
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76663619"
     variation       3544
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1420566018"
     variation       3549
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1388826069"
     variation       3559
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1477126416"
     variation       3560
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1266548604"
     variation       3561
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1221401092"
     variation       3564
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181202557"
     variation       3566
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:970422720"
     variation       3567
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1003349395"
     variation       3569
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1031219022"
     variation       3589..3592
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="tgta"
                     /replace="tgtatgta"
                     /db_xref="dbSNP:1388807263"
     variation       3589
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:972052278"
     variation       3590
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:919299434"
     variation       3592
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:954762680"
     variation       3598
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1325979077"
     variation       3601
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216668565"
     variation       3602
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571598262"
     variation       3603
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280050637"
     variation       3610
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541519426"
     variation       3621
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1368048861"
     variation       3625
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:987585847"
     variation       3626
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:559448001"
     variation       3628
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1355190833"
     variation       3632
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:989843539"
     variation       3635
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:547139777"
     variation       3636
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762841858"
     variation       3639
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:953389373"
     variation       3649
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:574906370"
     variation       3652..3653
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1571598340"
     variation       3657
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186202087"
     variation       3658
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210108945"
     variation       3659
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944731635"
     variation       3674
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1260410405"
     variation       3676
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:563558792"
     variation       3678
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251413150"
     variation       3690
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:895515882"
     variation       3691
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:919452739"
     variation       3695
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1013932193"
     variation       3696
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930823816"
     variation       3698
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1224579749"
     variation       3706
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1044172557"
     variation       3714
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1391357322"
     variation       3716..3722
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ttat"
                     /replace="ttattat"
                     /db_xref="dbSNP:1374626867"
     variation       3724
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:117706497"
     variation       3738
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1445875602"
     variation       3748
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:894716280"
     variation       3751
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1367124941"
     variation       3754
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1011881164"
     variation       3759
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1471043083"
     variation       3766
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016879407"
     variation       3770
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12563630"
     variation       3771
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1156615764"
     variation       3779
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1418452264"
     variation       3780..3794
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="gcg"
                     /replace="gcgttgactcatgcg"
                     /db_xref="dbSNP:1251125243"
     variation       3780
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1334453959"
     variation       3781
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:899413287"
     variation       3782
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1242210017"
     variation       3787
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459620321"
     variation       3788
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325195427"
     variation       3793
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191711871"
     variation       3794
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2246211"
     variation       3795
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:954711184"
     variation       3797
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2246210"
     variation       3803
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1243951702"
     variation       3808
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771210001"
     variation       3809
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017696014"
     variation       3810
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:956009378"
     variation       3820
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1454806458"
     variation       3821
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2246209"
     variation       3823
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286948931"
     variation       3824
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:925810850"
     variation       3826
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:567692789"
     variation       3834
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:767163168"
     variation       3835
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1414165131"
     variation       3846
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:934567766"
     variation       3848
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1010728915"
     variation       3849
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1022648188"
     variation       3856
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1228313714"
     variation       3857
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259818806"
     variation       3861
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1486392523"
     variation       3869
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1350782101"
     variation       3872..3873
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1244424411"
     variation       3880
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1359294642"
     variation       3881
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569262896"
     variation       3894
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044505683"
     variation       3900
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1324945048"
     variation       3909
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1295120319"
     variation       3910
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:986135138"
     variation       3916
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1381496235"
     variation       3917
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1018920856"
     variation       3923
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542060252"
     variation       3939
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1488883959"
     variation       3948
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1299766721"
     variation       3949
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:941148166"
     variation       3950
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2690033"
     variation       3960
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139907402"
     variation       3961
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1026569315"
     variation       3964
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:537395380"
     variation       3968
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145348903"
     variation       3971
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:183934944"
     variation       3991
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363455014"
     variation       3994
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:916182446"
     variation       3998
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:948933883"
     variation       4005
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220653940"
     variation       4007..4013
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="at"
                     /replace="ataagat"
                     /db_xref="dbSNP:1418165321"
     variation       4019
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1045954158"
     variation       4021
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:906248227"
     variation       4031
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1293095683"
     variation       4033
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114820141"
     variation       4049
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:964804932"
     variation       4050..4056
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="aaaa"
                     /replace="aaaaaaa"
                     /db_xref="dbSNP:372388889"
     variation       4057
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1228469115"
     variation       4057
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:879071378"
     variation       4060
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1052644509"
     variation       4061
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1279914970"
     variation       4062
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1434007097"
     variation       4063
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1402841669"
     variation       4068
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1301041672"
     variation       4069
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372777927"
     variation       4070..4088
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ttttattttatttt"
                     /replace="ttttattttattttatttt"
                     /db_xref="dbSNP:756491121"
     variation       4079
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:879176092"
     variation       4081
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1303679522"
     variation       4084
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:879053569"
     variation       4085
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1406964147"
     variation       4097
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1396400937"
     variation       4100
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1393703128"
     variation       4102
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:892188470"
     variation       4103
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187215029"
     variation       4119
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1374411531"
     variation       4125..4127
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:34116875"
     variation       4126
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:917174879"
     variation       4127
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:950043894"
     variation       4138
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1270307359"
     variation       4142
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:879217485"
     variation       4162
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:889046379"
     variation       4163
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436510047"
     variation       4176
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147273476"
     variation       4181
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2690032"
     variation       4183
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1341784413"
     variation       4188
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1261493806"
     variation       4194
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:557434740"
     variation       4196
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209981679"
     variation       4197
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1254768700"
     variation       4201
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1283615111"
     variation       4204
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1333855882"
     variation       4219
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1038142410"
     variation       4220
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1402102974"
     variation       4221
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148733300"
     variation       4223
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571599147"
     variation       4226..4229
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:747755518"
     variation       4226
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571599158"
     variation       4228
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1026828585"
     variation       4229
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571599192"
     variation       4235
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1482801066"
     variation       4236
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1232780256"
     variation       4239
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438028527"
     variation       4247
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:952140016"
     variation       4248
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1182708915"
     variation       4257
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1380947790"
     variation       4263
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142412849"
     variation       4265
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1241294834"
     variation       4266
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1009585306"
     variation       4267
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1039019969"
     variation       4269
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190786856"
     variation       4277
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1220714238"
     variation       4288
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173789655"
     variation       4303
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571599290"
     variation       4304
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1360843574"
     variation       4316
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1239206861"
     variation       4329
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558186634"
     variation       4333
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:528312668"
     variation       4343
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:948886681"
     variation       4352
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:540083615"
     variation       4353
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1000264200"
     variation       4354
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297359425"
     variation       4355
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571599365"
     variation       4360
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:928878996"
     variation       4361
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033062029"
     variation       4362
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151293580"
     variation       4364
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1010017587"
     variation       4365
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1052085390"
     variation       4366
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383505787"
     variation       4367
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1216981325"
     variation       4380
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182339834"
     variation       4381
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302847906"
     variation       4395
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:892215447"
     variation       4402
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:971321819"
     variation       4405
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314456961"
     variation       4406
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946455764"
     variation       4408
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1283221110"
     variation       4420
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:550157951"
     variation       4421
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:888988658"
     variation       4424
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355715785"
     variation       4433
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1007379769"
     variation       4437
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558186749"
     variation       4440
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1456736289"
     variation       4445
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1244561451"
     variation       4447
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1383159127"
     variation       4449
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1018901056"
     variation       4465
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1428149623"
     variation       4466
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:926954017"
     variation       4469
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:568516438"
     variation       4471
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:531071745"
     variation       4474..4488
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="t"
                     /replace="tgattgttagccgat"
                     /db_xref="dbSNP:1344981281"
     variation       4478
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:901729911"
     variation       4485
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1319342676"
     variation       4486
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1239027148"
     variation       4488
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1200246285"
     variation       4490
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163057648"
     variation       4496
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1445313853"
     variation       4506..4521
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ctta"
                     /replace="cttagcaactgcctta"
                     /db_xref="dbSNP:1022652847"
     variation       4506
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185014286"
     variation       4507
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1475170460"
     variation       4510
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1241338606"
     variation       4520
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1477708339"
     variation       4525
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:552851285"
     variation       4531
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41305050"
     variation       4533
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1489253564"
     variation       4537
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:973784017"
     variation       4538
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:993923185"
     variation       4539
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1026274841"
     variation       4540
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:952234783"
     variation       4542
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1360774156"
     variation       4543
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1271184813"
     variation       4546
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1402208377"
     variation       4550
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571599693"
     variation       4553
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1344247321"
     variation       4555
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755296661"
     variation       4556
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:912074043"
     variation       4566..4570
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1169899227"
     variation       4572
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778899873"
     variation       4578
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1409633429"
     variation       4579
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1420467058"
     variation       4580
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194203215"
     variation       4583
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3171000"
     variation       4584
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1466995209"
     variation       4590
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566928728"
     variation       4598
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1198603416"
     variation       4600
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755499780"
     variation       4601
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1247968917"
     variation       4606
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1201793553"
     variation       4612
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306604946"
     variation       4615
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571599801"
     variation       4617
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1258304017"
     variation       4618
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767606068"
     variation       4620
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220915008"
     variation       4622
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:535203133"
     variation       4640
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558187005"
     variation       4659
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393259783"
     variation       4660
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571599851"
     variation       4675
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1406127751"
     variation       4679
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1370298529"
     variation       4682..4684
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:779266252"
     variation       4684..4685
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="ta"
                     /db_xref="dbSNP:1296574221"
     variation       4687
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748240123"
     variation       4691
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056426"
     variation       4692
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173108745"
     variation       4697
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1000162177"
     variation       4699
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:988223305"
     variation       4707
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1175380713"
     variation       4712
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:891878604"
     variation       4713
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1010301135"
     variation       4717
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:34322240"
     variation       4722
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220269797"
     variation       4723
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175046490"
     variation       4725
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1024081078"
     variation       4730
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1238195807"
     variation       4731
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:865967509"
     variation       4735
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:971651298"
     variation       4738
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001417918"
     variation       4743
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1316380359"
     variation       4755
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1220866878"
     variation       4760
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1234395932"
     variation       4766
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1034686584"
     variation       4780
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:568564974"
     variation       4782..4783
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:747158578"
     variation       4782..4783
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:35364522"
     variation       4782
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571599991"
     variation       4783..4784
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:573898648"
     variation       4783
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:76338423"
     variation       4784..4793
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="ttttttttt"
                     /replace="tttttttttt"
                     /replace="ttttttttttt"
                     /db_xref="dbSNP:550551812"
     variation       4784
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219702667"
     variation       4791
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1335881796"
     variation       4793
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750307369"
     variation       4794
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1156856768"
     variation       4794
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488865677"
     variation       4796
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1043517339"
     variation       4797
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772122448"
     variation       4797
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="t"
                     /replace="ttt"
                     /db_xref="dbSNP:1553283118"
     variation       4798
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1192766308"
     variation       4802
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1421403552"
     variation       4806
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1179917788"
     variation       4811
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478794683"
     variation       4818
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442449732"
     variation       4819
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1242110273"
     variation       4823
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1201444008"
     variation       4824
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:951097549"
     variation       4826
                     /gene="NR5A2"
                     /gene_synonym="B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta;
                     hB1F-2; LRH-1; LRH1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:910288784"
ORIGIN      
gctttttcttaactttcactaagggttactgtagtctgatgtgtccttcccaaggccacgaaatttgacaagctgcacttttcttttgctcaatgatttctgctttaagccaaagaactgcctataatttcactaagaatgtcttctaattcagatactggggatttacaagagtctttaaagcacggacttacacctattgtgtctcaatttaaaatggtgaattactcctatgatgaagatctggaagagctttgtcccgtgtgtggagataaagtgtctgggtaccattatgggctcctcacctgtgaaagctgcaagggattttttaagcgaacagtccaaaataataaaaggtacacatgtatagaaaaccagaactgccaaattgacaaaacacagagaaagcgttgtccttactgtcgttttcaaaaatgtctaagtgttggaatgaagctagaagctgtaagggccgaccgaatgcgtggaggaaggaataagtttgggccaatgtacaagagagacagggccctgaagcaacagaaaaaagccctcatccgagccaatggacttaagctagaagccatgtctcaggtgatccaagctatgccctctgacctgaccatttcctctgcaattcaaaacatccactctgcctccaaaggcctacctctgaaccatgctgccttgcctcctacagactatgacagaagtccctttgtaacatcccccattagcatgacaatgccccctcacggcagcctgcaaggttaccaaacatatggccactttcctagccgggccatcaagtctgagtacccagacccctataccagctcacccgagtccataatgggctattcatatatggatagttaccagacgagctctccagcaagcatcccacatctgatactggaacttttgaagtgtgagccagatgagcctcaagtccaggctaaaatcatggcctatttgcagcaagagcaggctaaccgaagcaagcacgaaaagctgagcacctttgggcttatgtgcaaaatggcagatcaaactctcttctccattgtcgagtgggccaggagtagtatcttcttcagagaacttaaggttgatgaccaaatgaagctgcttcagaactgctggagtgagctcttaatcctcgaccacatttaccgacaagtggtacatggaaaggaaggatccatcttcctggttactgggcaacaagtggactattccataatagcatcacaagccggagccaccctcaacaacctcatgagtcatgcacaggagttagtggcaaaacttcgttctctccagtttgatcaacgagagttcgtatgtctgaaattcttggtgctctttagtttagatgtcaaaaaccttgaaaacttccagctggtagaaggtgtccaggaacaagtcaatgccgccctgctggactacacaatgtgtaactacccgcagcagacagagaaatttggacagctacttcttcgactacccgaaatccgggccatcagtatgcaggctgaagaatacctctactacaagcacctgaacggggatgtgccctataataaccttctcattgaaatgttgcatgccaaaagagcataagttacaacccctaggagctctgctttcaaaacaaaaagagattgggggagtggggagggggaagaagaacaggaagaaaaaaagtactctgaactgctccaagtaacgctaattaaaaacttgctttaaagatattgaatttaaaaaggcataataatcaaatacttaatagcaaataaatgatgtatcagggtatttgtattgcaaactgtgaatcaaaggcttcacagccccagaggattccatataaaagacattgtaatggagtggattgaactcacagatggataccaacacggtcagaagaaaaacggacagaacggttcttgtatatttaaactgatctccactatgaagaaatttaggaactaatcttattaattaggcttatacagcgggggatttgagcttacaggattcctccatggtaaagctgaactgaaacaattctcaagaatgcatcagctgtacctacaatagcccctccctcttcctttgaaggccccagcacctctgccctgtggtcaccgaatctgtactaaggacctgtgttcagccacacccagtggtagctccaccaaatcatgaacagcctaattttgagtgtctgtgtcttagacctgcaaacagctaataggaaattctattaatatgttagcttgccattttaaatatgttctgagggttgttttgtctcgtgttcatgatgttaagaaaatgcaggcagtatccctcatcttatgtaagtgttaattaatattaagggaaatgactacaaactttcaaagcaaatgctccatagctaaagcaacttagaccttatttctgctactgttgctgaaatgtggctttggcattgttggatttcataaaaaatttctggcaggaagtcttgttagtatacatcagtctttttcatcatccaagtttgtagttcatttaaaaatacaacattaaacacattttgctaggatgtcaaatagtcacagttctaagtagttggaaacaaaattgacgcatgttaatctatgcaaagagaaaggaaaggatgaggtgatgtattgactcaaggttcattcttgctgcaattgaacatcctcaagagttgggatggaaatggtgatttttacatgtgtcctggaaagatattaaagtaattcaaatcttccccaaaggggaaaggaagagagtgatactgacctttttaagtcatagaccaaagtctgctgtagaacaaatatgggaggacaaagaatcgcaaattcttcaaatgactattatcagtattattaacatgcgatgccacaggtatgaaagtcttgccttatttcacaattttaaaaggtagctgtgcagatgtggatcaacatttgtttaaaataaagtattaatactttaaagtcaaataagatatagtgtttacattctttaggtcctgaggggcagggggatctgtgatataacaaaatagcaaaagcggtaatttccttaatgttatttttctgattggtaattatttttaacagtacttaattattctatgtcgtgagacactaaaatcaaaaacgggaatctcatttagactttaatttttttgagattatcggcggcacaatcactttgtagaaactgtaaaaaataaaagtatctcctagtcccttaattttttcataaatatttctggcttttgagtagtgtatttatattgtatatcatactttcaactgtagacaattatgatgctaatttattgtttcttggtttcacctttgtataagatatagccaagactgaagaaaccaaatatatgtgtttactgtagcatgtcttcaaattagtggaacttagttcagggacatagaagagtcttaatgaattaaaatcattcacttgattaaatgtctgtaaatcttcatcattcctactgtagtttatttaatatctattgtaaattatgtgacttgtagcttcctctggttttcaagtaaactcaacaaggtggagtcttacctggttttcctttccaagcattgtaaattgtataccaaagatattagttattacttctgtgtgtacaaagaggattattttattatgtttattaatcacctctaatactcatccacatgaagggtacacattaggtaagctgggcgttgactcatgcgcagtctcagtcacccgtgttatcttcgtggctcaaaggacaatgcaaaatcgccgatcagagctcatacccaaagcattacagagaacagcagcatcattgccctccccagctgaaaaacaagttggctagaagatacatggagaggaatggtgtggtcaacagttaatgaaacggttctatcatgcatgtgtaatgtggatggagacaattataagatttgactataactatttggagggtctttaacattgccaaaaaaacaaatatgttgatttttattttattttattttttattttaagaggcgggatcttgatctcacatgttgcccaggctggccttgaactcctgggctcaagcattcctcctgcctcagcctcccccatagctgggactaggggtgcatgccagcatacctggctacgttgactcttaaaatctatgttctcttattttaaagatacagtgctccccactgaaaattaaacctaaaaaatgtcacatattggtatgttgttaacctggtagattaaatcatgagaatgattagaaagacgggcaacacagcgggttacatccacactgctgatcacaccaacgacaggagctgataagcaagaaagcgtcacagccagcgtctgttcacccaaggttgacaagtgaagtttctctaatgttgattgttagccgatttgtaacctggcatttacttagcaactgccttatcaattacaggatttgccggtaaaagcagactcaaatataaaggtttttggcttaacttggtttattatagttgctctatgtttgtaaacagacaatctctaatgtctgattatttgtatcacagatctgcagctgccttggacttgaatccatgcaatgtttagagtgtgaagtcagttacttgttgatgttttcttactgtatcaatgaaatacatattgtcatgtcagttcttgccaggaacttctcaacaaaatggaattttttttttcagtatttcaataaatattgatatgcccagcctgataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]