GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 22:52:00, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_003563               3053 bp    mRNA    linear   PRI 21-JAN-2020
DEFINITION  Homo sapiens speckle type BTB/POZ protein (SPOP), transcript
            variant 2, mRNA.
ACCESSION   NM_003563
VERSION     NM_003563.3
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3053)
  AUTHORS   Hernandez-Llodra S, Segales L, Safont A, Juanpere N, Lorenzo M,
            Fumado L, Rodriguez-Vida A, Cecchini L, Bellmunt J and
            Lloreta-Trull J.
  TITLE     SPOP and FOXA1 mutations are associated with PSA recurrence in ERG
            wt tumors, and SPOP downregulation with ERG-rearranged prostate
            cancer
  JOURNAL   Prostate 79 (10), 1156-1165 (2019)
   PUBMED   31090082
  REMARK    GeneRIF: In conclusion, SPOP and FOXA1 mutations may have
            prognostic value in ERG wt prostate tumors.
REFERENCE   2  (bases 1 to 3053)
  AUTHORS   Gang X, Xuan L, Zhao X, Lv Y, Li F, Wang Y and Wang G.
  TITLE     Speckle-type POZ protein suppresses lipid accumulation and prostate
            cancer growth by stabilizing fatty acid synthase
  JOURNAL   Prostate 79 (8), 864-871 (2019)
   PUBMED   30955223
  REMARK    GeneRIF: Data provide evidence that SPOP regulates lipid metabolism
            by decreasing FASN expression and FA synthesis, resulting in tumor
            suppression.
REFERENCE   3  (bases 1 to 3053)
  AUTHORS   Zhang J, Chen M, Zhu Y, Dai X, Dang F, Ren J, Ren S, Shulga YV,
            Beca F, Gan W, Wu F, Lin YM, Zhou X, DeCaprio JA, Beck AH, Lu KP,
            Huang J, Zhao C, Sun Y, Gao X, Pandolfi PP and Wei W.
  TITLE     SPOP Promotes Nanog Destruction to Suppress Stem Cell Traits and
            Prostate Cancer Progression
  JOURNAL   Dev. Cell 48 (3), 329-344 (2019)
   PUBMED   30595538
  REMARK    GeneRIF: cancer-derived mutations in SPOP or at the Nanog-degron
            (S68Y) disrupt SPOP-mediated destruction of Nanog, leading to
            elevated cancer stem cell traits and PrCa progression
REFERENCE   4  (bases 1 to 3053)
  AUTHORS   Fong KW, Zhao JC, Song B, Zheng B and Yu J.
  TITLE     TRIM28 protects TRIM24 from SPOP-mediated degradation and promotes
            prostate cancer progression
  JOURNAL   Nat Commun 9 (1), 5007 (2018)
   PUBMED   30479348
  REMARK    GeneRIF: TRIM24 and AR coactivated gene signature of SPOP-mutant
            prostate cancer (PCa) is similarly activated in human PCa with high
            TRIM28 expression.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 3053)
  AUTHORS   Bouchard JJ, Otero JH, Scott DC, Szulc E, Martin EW, Sabri N,
            Granata D, Marzahn MR, Lindorff-Larsen K, Salvatella X, Schulman BA
            and Mittag T.
  TITLE     Cancer Mutations of the Tumor Suppressor SPOP Disrupt the Formation
            of Active, Phase-Separated Compartments
  JOURNAL   Mol. Cell 72 (1), 19-36 (2018)
   PUBMED   30244836
  REMARK    GeneRIF: Disease-associated SPOP mutations that lead to the
            accumulation of proto-oncogenic proteins interfere with phase
            separation and co-localization in membraneless organelles,
            suggesting that substrate-directed phase separation of this E3
            ligase underlies the regulation of ubiquitin-dependent proteostasis
REFERENCE   6  (bases 1 to 3053)
  AUTHORS   Diefenbach A, Tomasello E, Lucas M, Jamieson AM, Hsia JK, Vivier E
            and Raulet DH.
  TITLE     Selective associations with signaling proteins determine
            stimulatory versus costimulatory activity of NKG2D
  JOURNAL   Nat. Immunol. 3 (12), 1142-1149 (2002)
   PUBMED   12426565
  REMARK    Erratum:[Nat Immunol. 2004 Jun;5(6):658]
REFERENCE   7  (bases 1 to 3053)
  AUTHORS   Gilfillan S, Ho EL, Cella M, Yokoyama WM and Colonna M.
  TITLE     NKG2D recruits two distinct adapters to trigger NK cell activation
            and costimulation
  JOURNAL   Nat. Immunol. 3 (12), 1150-1155 (2002)
   PUBMED   12426564
REFERENCE   8  (bases 1 to 3053)
  AUTHORS   Zapata JM, Pawlowski K, Haas E, Ware CF, Godzik A and Reed JC.
  TITLE     A diverse family of proteins containing tumor necrosis factor
            receptor-associated factor domains
  JOURNAL   J. Biol. Chem. 276 (26), 24242-24252 (2001)
   PUBMED   11279055
REFERENCE   9  (bases 1 to 3053)
  AUTHORS   Wu J, Song Y, Bakker AB, Bauer S, Spies T, Lanier LL and Phillips
            JH.
  TITLE     An activating immunoreceptor complex formed by NKG2D and DAP10
  JOURNAL   Science 285 (5428), 730-732 (1999)
   PUBMED   10426994
REFERENCE   10 (bases 1 to 3053)
  AUTHORS   Nagai Y, Kojima T, Muro Y, Hachiya T, Nishizawa Y, Wakabayashi T
            and Hagiwara M.
  TITLE     Identification of a novel nuclear speckle-type protein, SPOP
  JOURNAL   FEBS Lett. 418 (1-2), 23-26 (1997)
   PUBMED   9414087
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BX282325.1, BC001269.1,
            AK123385.1, W84567.1, BM693397.1, BQ226031.1 and AW449169.1.
            On Nov 29, 2004 this sequence version replaced NM_003563.2.
            
            Summary: This gene encodes a protein that may modulate the
            transcriptional repression activities of death-associated protein 6
            (DAXX), which interacts with histone deacetylase, core histones,
            and other histone-associated proteins. In mouse, the encoded
            protein binds to the putative leucine zipper domain of macroH2A1.2,
            a variant H2A histone that is enriched on inactivated X
            chromosomes. The BTB/POZ domain of this protein has been shown in
            other proteins to mediate transcriptional repression and to
            interact with components of histone deacetylase co-repressor
            complexes. Alternative splicing of this gene results in multiple
            transcript variants encoding the same protein. [provided by RefSeq,
            Jul 2008].
            
            Transcript Variant: This variant (2) differs in the 5' UTR compared
            to variant 1. Transcript variants 1-6 encode the same protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1163658.153619.1,
                                           SRR1803612.214214.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-353               BX282325.1         1-353
            354-1904            BC001269.1         238-1788
            1905-1914           AK123385.1         1615-1624
            1915-1915           W84567.1           272-272
            1916-1916           BM693397.1         322-322
            1917-2425           AK123385.1         1625-2133
            2426-2638           BQ226031.1         245-457
            2639-3053           AW449169.1         1-415               c
FEATURES             Location/Qualifiers
     source          1..3053
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q21.33"
     gene            1..3053
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="speckle type BTB/POZ protein"
                     /db_xref="GeneID:8405"
                     /db_xref="HGNC:HGNC:11254"
                     /db_xref="MIM:602650"
     exon            1..231
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1309372632"
     variation       4
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:895708523"
     variation       7
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1003444226"
     variation       8
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1168759001"
     variation       11
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1390266268"
     variation       12
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:564104381"
     variation       13
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295190272"
     variation       16
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1198254534"
     variation       18
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001496705"
     variation       21
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:550960544"
     variation       22
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:947786168"
     variation       23
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1038399438"
     variation       25
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1364725267"
     variation       27
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1367703177"
     variation       28
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:530858573"
     variation       38
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1048493666"
     variation       40
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1047187388"
     variation       44
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934167539"
     variation       46
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1266599200"
     variation       48
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:922819317"
     variation       49
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:929674863"
     variation       54
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1212601670"
     variation       55
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1250608141"
     variation       60
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1450726394"
     variation       61
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1186761388"
     variation       68
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:976068022"
     variation       70
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760495856"
     variation       71..74
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1381097604"
     variation       73
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1166621056"
     variation       74
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:972299000"
     variation       79..95
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ggtgtgt"
                     /replace="ggtgtgtgtcggtgtgt"
                     /db_xref="dbSNP:1360110672"
     variation       80..107
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgtgtcggtgtgtatgtgtgtgtgt"
                     /replace="gtgtgtgtcggtgtgtatgtgtgtgtgtcggtgtgtatgtgtgtgtgt
                     "
                     /db_xref="dbSNP:1491535538"
     variation       80
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:966308802"
     variation       88
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1390955610"
     variation       89
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1435855722"
     variation       90..95
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gt"
                     /replace="gtgtgt"
                     /db_xref="dbSNP:1567811374"
     variation       92
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:925596553"
     variation       95..97
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tat"
                     /db_xref="dbSNP:967098125"
     variation       96
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:912063943"
     variation       97..134
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tgtgtgtgt"
                     /replace="tgtgtgtgtgtgagtgtgcgcgctccgagtgtgtgtgt"
                     /db_xref="dbSNP:1401407332"
     variation       97..108
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tgtgtgtgtg"
                     /replace="tgtgtgtgtgtg"
                     /replace="tgtgtgtgtgtgtg"
                     /db_xref="dbSNP:752650296"
     variation       98..134
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgtgtgt"
                     /replace="gtgtgtgtgtgagtgtgcgcgctccgagtgtgtgtgt"
                     /db_xref="dbSNP:1033156872"
     variation       98
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:986334117"
     variation       100..133
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgtgtg"
                     /replace="gtgtgtgtgagtgtgcgcgctccgagtgtgtgtg"
                     /db_xref="dbSNP:1355440883"
     variation       102
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1334539259"
     variation       106..112
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtg"
                     /replace="gtgagtg"
                     /db_xref="dbSNP:1192269966"
     variation       107
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:953554826"
     variation       110
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215848019"
     variation       116
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1490308364"
     variation       118
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1022381935"
     variation       121
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1011301564"
     variation       123
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1418311826"
     variation       125..134
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gtgtgt"
                     /replace="gtgtgtgtgt"
                     /db_xref="dbSNP:1343720566"
     variation       125
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:956744998"
     variation       131
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474729775"
     variation       133
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1030984031"
     variation       136
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:959856805"
     variation       146
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1034216945"
     variation       148
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1355254424"
     variation       155
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1413283945"
     variation       164
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183236673"
     variation       172
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:899103846"
     variation       185
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1003411727"
     variation       198
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1282938263"
     variation       213
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1314544979"
     variation       217
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:906492670"
     variation       222
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1211828659"
     variation       224
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1257730446"
     variation       225
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044841051"
     variation       227
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1012082736"
     variation       228
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:541995662"
     exon            232..353
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       234
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332364298"
     variation       235
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:550114413"
     variation       237
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1444748358"
     variation       249
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1303878772"
     variation       251
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1007707925"
     variation       252
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:530369870"
     variation       253
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1326418617"
     variation       268
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:953179195"
     variation       272
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1254739334"
     variation       273
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959688382"
     variation       277
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1034255310"
     variation       278
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562570658"
     variation       280
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995692146"
     variation       292
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1258385316"
     variation       313
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:561417975"
     variation       314
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1175065676"
     variation       318
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:892355762"
     variation       320
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1567809787"
     variation       321
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198133374"
     variation       331
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1375846297"
     variation       335
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1344484642"
     variation       336
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1015699069"
     variation       338
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300982728"
     variation       346
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1384263367"
     variation       352
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:574403578"
     exon            354..497
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       362
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:552678071"
     variation       364
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1303233302"
     variation       365
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:898358701"
     variation       374
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375760414"
     variation       375
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1004573148"
     variation       377
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770523866"
     variation       379
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748907854"
     variation       380
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200154697"
     variation       381
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747556061"
     variation       383..384
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:770983446"
     variation       383
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1236595064"
     misc_feature    384..386
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="upstream in-frame stop codon"
     variation       384
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1211239574"
     variation       388
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:550262239"
     variation       391
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1485139008"
     variation       395
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283063006"
     variation       399
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369359417"
     variation       401
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:762810448"
     variation       403
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:746247721"
     variation       405
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779298365"
     variation       407
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369944128"
     variation       412
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:530576210"
     variation       418
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756180522"
     variation       419
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1445881208"
     CDS             420..1544
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="HIB homolog 1; roadkill homolog 1"
                     /codon_start=1
                     /product="speckle-type POZ protein"
                     /protein_id="NP_003554.1"
                     /db_xref="CCDS:CCDS11551.1"
                     /db_xref="GeneID:8405"
                     /db_xref="HGNC:HGNC:11254"
                     /db_xref="MIM:602650"
                     /translation="
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS"
     misc_feature    501..917
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="Speckle-type POZ protein (SPOP) family, MATH
                     domain; composed of proteins with similarity to human
                     SPOP. SPOP was isolated as a novel antigen recognized by
                     serum from a scleroderma patient, whose overexpression in
                     COS cells results in a discrete speckled...; Region:
                     MATH_SPOP; cd03774"
                     /db_xref="CDD:239743"
     misc_feature    630..992
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Required for nuclear localization"
     misc_feature    order(678..680,807..815)
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239743"
     misc_feature    786..818
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Important for binding substrate proteins"
     misc_feature    963..1322
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ
                     (poxvirus and zinc finger) domain found in speckle-type
                     POZ protein (SPOP) and similar proteins; Region:
                     BTB_POZ_SPOP-like; cd18279"
                     /db_xref="CDD:349588"
     misc_feature    975..1070
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Important for homodimerization"
     misc_feature    1308..1520
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /note="BACK (BTB and C-terminal Kelch) domain found in
                     speckle-type POZ protein (SPOP); Region: BACK_SPOP;
                     cd18518"
                     /db_xref="CDD:350593"
     misc_feature    1308..1484
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O43791.1);
                     Region: Important for homodimerization"
     variation       432
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1357465839"
     variation       444
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1176154786"
     variation       447
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752686914"
     variation       448
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767367200"
     variation       449
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:189212134"
     variation       452
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138762009"
     variation       458
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1410388458"
     variation       460
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412582124"
     variation       461
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150193528"
     variation       463
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1033673807"
     variation       464
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375966583"
     variation       467
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:747676565"
     variation       470
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:528362520"
     variation       471
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746338468"
     variation       479
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1174659692"
     variation       488
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:577150644"
     variation       491
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308493304"
     variation       494
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1289358875"
     exon            498..619
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       500
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:935757299"
     variation       503
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1233295619"
     variation       518
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749665129"
     variation       530
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1172367957"
     variation       533
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436918312"
     variation       535
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201537546"
     variation       551
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778043495"
     variation       557
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1278407528"
     variation       585
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188095610"
     variation       587
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770032061"
     variation       593
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1264201283"
     variation       599
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748317501"
     variation       601
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781175213"
     variation       602
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1254155223"
     variation       617
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249996971"
     exon            620..771
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       626
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006145755"
     variation       635
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:544086490"
     variation       644
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1251477344"
     variation       650
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1047630305"
     variation       669
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780244378"
     variation       678
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1057519972"
     variation       679
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1057519971"
     variation       683
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1294614519"
     variation       684
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216697499"
     variation       711
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1233429922"
     variation       714
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866898949"
     variation       723
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519964"
     variation       724..737
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tcaaattctccatc"
                     /replace="tcaaattctccatcaaattctccatc"
                     /db_xref="dbSNP:1308009290"
     variation       724
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:193920894"
     variation       725
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519965"
     variation       749
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:878903236"
     variation       761
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758435270"
     variation       767
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1399114184"
     exon            772..899
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       785
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:910219777"
     variation       791
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367994374"
     variation       797
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777389504"
     variation       803
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464021387"
     variation       809
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1239714436"
     variation       810
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519968"
     variation       811
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1057519969"
     variation       812
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519970"
     variation       816
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519966"
     variation       817
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057519967"
     variation       818
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:193921065"
     variation       823
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1006096444"
     variation       827
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755810590"
     variation       831
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968974699"
     variation       833
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:888419251"
     variation       836
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:914728063"
     variation       842
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752320964"
     variation       847
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1369267775"
     variation       853
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113265648"
     variation       859
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186813947"
     variation       860
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767050824"
     variation       869
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1441922674"
     variation       890
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754476215"
     variation       893
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368288966"
     variation       896
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375093038"
     exon            900..1077
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       905
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1484969675"
     variation       911
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747860563"
     variation       921
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1212007091"
     variation       922
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1204280245"
     variation       925
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437667184"
     variation       927
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1260807436"
     variation       941
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1271091972"
     variation       944
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1327381298"
     variation       946
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216583404"
     variation       952
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1340081446"
     variation       959
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567773264"
     variation       965
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292730217"
     variation       970
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1476294846"
     variation       971
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780840574"
     variation       973
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200866660"
     variation       977
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754562658"
     variation       980
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944205508"
     variation       996
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568477610"
     variation       1009
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866413895"
     variation       1010
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:548343856"
     variation       1011
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:985933794"
     variation       1012
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779385564"
     variation       1017
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757833097"
     variation       1026
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1346246121"
     variation       1028
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754270875"
     variation       1030
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389640010"
     variation       1031
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764587660"
     variation       1032
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1475940002"
     variation       1033
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1420633752"
     variation       1035
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760936126"
     variation       1037
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140932511"
     variation       1040
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148282868"
     variation       1041
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313171285"
     variation       1054
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759790566"
     variation       1058
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438582241"
     variation       1061
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1272864182"
     variation       1068
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211887878"
     exon            1078..1133
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1078
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753143058"
     variation       1079
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1259088100"
     variation       1080
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1484517050"
     variation       1082
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1315023933"
     variation       1087
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767942932"
     variation       1088
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759885928"
     variation       1097
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1567771033"
     variation       1118
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1369992087"
     variation       1119
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300720198"
     variation       1121
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442685755"
     variation       1122
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371025799"
     variation       1124
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:933490114"
     variation       1126
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428127345"
     variation       1127
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1343939111"
     exon            1134..1256
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1142
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1407495857"
     variation       1148
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1170022058"
     variation       1150
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369378549"
     variation       1157
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546426832"
     variation       1160
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766519919"
     variation       1161
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567770650"
     variation       1180
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1338311086"
     variation       1181
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1042535989"
     variation       1193
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1279631023"
     variation       1198
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376811676"
     variation       1199
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1212744009"
     variation       1214
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1485886229"
     variation       1217
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765280957"
     variation       1218
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868702285"
     variation       1222
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373610541"
     variation       1229
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:776546524"
     variation       1239
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1232195212"
     variation       1256
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355380144"
     exon            1257..1399
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1265
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1188835721"
     variation       1268
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747335231"
     variation       1272
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780421201"
     variation       1277
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758599151"
     variation       1291
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:937097664"
     variation       1294
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200147245"
     variation       1297
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1477707238"
     variation       1298
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765368825"
     variation       1303
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406463841"
     variation       1306
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:727502792"
     variation       1307
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757317825"
     variation       1308
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460928181"
     variation       1313
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146116174"
     variation       1314
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371674237"
     variation       1316..1317
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1567767320"
     variation       1322
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142247620"
     variation       1325
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200881785"
     variation       1337
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767319726"
     variation       1340
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147619581"
     variation       1346
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113808176"
     variation       1347
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1399168977"
     variation       1359
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1276142369"
     variation       1361
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770620764"
     variation       1364
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762562177"
     variation       1367
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567767288"
     variation       1368
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429805459"
     variation       1376
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148851634"
     variation       1380
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1466718093"
     variation       1381
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1274528044"
     variation       1392
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:890324763"
     variation       1393
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1209961119"
     exon            1400..3038
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /inference="alignment:Splign:2.1.0"
     variation       1409
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160405402"
     variation       1435
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:907969016"
     variation       1437
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781763948"
     variation       1439
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445972010"
     variation       1445
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1198189256"
     variation       1446
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1030014457"
     variation       1447
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1261567055"
     variation       1457
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752649235"
     variation       1460
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1567766372"
     variation       1475
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767281381"
     variation       1479
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759358719"
     variation       1480
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438495852"
     variation       1485
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751337978"
     variation       1490
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766130846"
     variation       1494
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762651623"
     variation       1499
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772900427"
     variation       1502
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275682069"
     variation       1504
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1052158260"
     variation       1505
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769319131"
     variation       1512
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1316085986"
     variation       1520
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1383872445"
     variation       1521
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761155742"
     variation       1522
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1380705599"
     variation       1523
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:776052725"
     variation       1527
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772401624"
     variation       1528
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1235434281"
     variation       1535
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746238687"
     variation       1538
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172810936"
     variation       1541
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1197356039"
     variation       1548..1549
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:767314540"
     variation       1548
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1222554351"
     variation       1551
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779211010"
     variation       1554
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771163040"
     variation       1558
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749487561"
     variation       1567
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374401933"
     variation       1568
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114710735"
     variation       1584
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781198550"
     variation       1588
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1280919140"
     variation       1590
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562050616"
     variation       1592
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:974683092"
     variation       1599
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:957847034"
     variation       1613
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1175381073"
     variation       1620
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039276410"
     variation       1621
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414777422"
     variation       1622
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1378708366"
     variation       1624
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:936518961"
     variation       1625
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:562382565"
     variation       1628
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467377714"
     variation       1639..1642
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1442009162"
     variation       1642
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1332200541"
     variation       1643
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aaa"
                     /db_xref="dbSNP:1376228588"
     variation       1645
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1042341294"
     variation       1648
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1277074514"
     variation       1652
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1368774705"
     variation       1655..1658
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1353270261"
     variation       1659
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:977971954"
     variation       1670
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:946005147"
     variation       1673
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1282246105"
     variation       1674
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757895299"
     variation       1678
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:966825580"
     variation       1686
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1200124894"
     variation       1692
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1258198352"
     variation       1693
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1436683982"
     variation       1699
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1024736466"
     variation       1701
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1013198961"
     variation       1706
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:548845383"
     variation       1712
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:959068792"
     variation       1716
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405971501"
     variation       1717..1722
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:1161792220"
     variation       1717
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1034543475"
     variation       1718
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1399680825"
     variation       1719
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1408226647"
     variation       1722
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001768556"
     variation       1731
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350906007"
     variation       1741
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1436380449"
     variation       1742
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111864010"
     variation       1748
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113925218"
     variation       1753
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381211799"
     variation       1754
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1038251848"
     variation       1762
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1480189223"
     variation       1765..1767
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1567766050"
     variation       1770
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752124955"
     variation       1778
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886488937"
     variation       1781
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111569143"
     variation       1785
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1291401520"
     variation       1787
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200436241"
     variation       1794..1797
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gg"
                     /replace="gggg"
                     /db_xref="dbSNP:373812698"
     variation       1794
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187597110"
     variation       1796
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759469033"
     variation       1797
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:963588932"
     variation       1798
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541437732"
     variation       1801
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:933290334"
     variation       1806
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290360318"
     variation       1810
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219681525"
     variation       1812
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:921956967"
     variation       1813
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764485328"
     variation       1814
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355391422"
     variation       1815..1816
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="ata"
                     /db_xref="dbSNP:1223513413"
     variation       1815
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039066718"
     variation       1816
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:936549467"
     variation       1818
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925229462"
     variation       1819
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371658362"
     variation       1822
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474468457"
     variation       1825
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016902315"
     variation       1826
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978296694"
     variation       1831
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763258628"
     variation       1832
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140827537"
     variation       1833
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:565391290"
     variation       1835
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146448668"
     variation       1837
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1362870075"
     variation       1840
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1400932236"
     variation       1844
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:959016638"
     variation       1865
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752911140"
     variation       1871
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:939909864"
     variation       1876
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325560884"
     variation       1881
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033276097"
     variation       1894
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1365558763"
     variation       1897
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1301352164"
     variation       1903..1904
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1289440048"
     variation       1903
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199896895"
     variation       1904
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421665204"
     variation       1905..1916
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaaaaaaaa"
                     /replace="aaaaaaaaaaa"
                     /replace="aaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaa"
                     /db_xref="dbSNP:rs5820770"
     variation       1915
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355597173"
     variation       1917
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:774692430"
     variation       1918..1920
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1345942108"
     variation       1922
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1158672009"
     variation       1923
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:995149163"
     variation       1935
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1029941160"
     variation       1943
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:997174152"
     variation       1948..1949
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="ttc"
                     /db_xref="dbSNP:1192747789"
     variation       1949
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1444032460"
     variation       1963
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1162239264"
     variation       1964..1968
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1420836859"
     variation       1964
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900210620"
     variation       1970
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1158414122"
     variation       1976
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1383237120"
     variation       1977
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017361208"
     variation       1987
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:963925437"
     variation       2008
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340568991"
     variation       2018
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540124961"
     variation       2021
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:903701740"
     variation       2025
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765423323"
     variation       2033
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1488989709"
     variation       2037
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1379107436"
     variation       2042
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016524104"
     variation       2047
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1005452858"
     variation       2053
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="ata"
                     /db_xref="dbSNP:1348236629"
     variation       2055
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202429883"
     variation       2061
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1279527989"
     variation       2066
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1315466095"
     variation       2071
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1281137740"
     variation       2073
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1240090018"
     variation       2074
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886635358"
     variation       2085
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224567259"
     variation       2088
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896436073"
     variation       2093
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11539921"
     variation       2095
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467852976"
     variation       2107
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:997572826"
     variation       2108..2115
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ttgtt"
                     /replace="ttgttgtt"
                     /db_xref="dbSNP:1044501333"
     variation       2110
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:938699740"
     variation       2114
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:927337779"
     variation       2115
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:563879503"
     variation       2124
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:942169671"
     variation       2134
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:556822256"
     variation       2144
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1401857871"
     variation       2151
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536928211"
     variation       2152
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:909367277"
     variation       2164..2168
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1333781824"
     variation       2169
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:574398448"
     variation       2172
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1039016931"
     variation       2173..2180
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aag"
                     /replace="aagtgaag"
                     /db_xref="dbSNP:1323169779"
     variation       2175
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202188913"
     variation       2188..2194
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="gg"
                     /replace="gggaagg"
                     /db_xref="dbSNP:1201987755"
     variation       2203
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:903762965"
     variation       2211
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:755339845"
     variation       2211
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775610764"
     variation       2215
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042349201"
     variation       2220
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945184221"
     variation       2222
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776756750"
     variation       2230
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917777067"
     variation       2243
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:553459320"
     variation       2252
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937736180"
     variation       2253
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1429009380"
     variation       2255
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1567765537"
     variation       2270
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020790901"
     variation       2271..2275
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aataa"
                     /db_xref="dbSNP:1451858319"
     variation       2294
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1009440766"
     variation       2302
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1061431"
     variation       2308
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1178306820"
     variation       2310
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1470186280"
     variation       2320
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745885945"
     variation       2325
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1428435266"
     variation       2332
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1303589744"
     variation       2334
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1197209690"
     variation       2350
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344604697"
     variation       2358
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1221951157"
     variation       2361
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1280288418"
     variation       2362
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1056404854"
     variation       2363
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1226691732"
     variation       2376
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429727570"
     variation       2378
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1261859092"
     variation       2382
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:879204747"
     variation       2383
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1489786536"
     variation       2388
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1484679592"
     variation       2392
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1238908405"
     variation       2393
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1204629523"
     variation       2394..2399
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /db_xref="dbSNP:1196864482"
     variation       2397..2407
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaacaaa"
                     /replace="aaacaaacaaa"
                     /db_xref="dbSNP:1323552367"
     variation       2400
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:878935173"
     variation       2401..2403
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:11372331"
     variation       2402..2403
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1425243840"
     variation       2403..2405
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:1491244321"
     variation       2403
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1003259201"
     variation       2404
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:11316512"
     variation       2404
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:60764900"
     variation       2405..2415
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /replace="aaaaaaaa"
                     /replace="aaaaaaaaa"
                     /replace="aaaaaaaaaa"
                     /replace="aaaaaaaaaaa"
                     /replace="aaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaaa"
                     /db_xref="dbSNP:rs112880999"
     variation       2405
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aga"
                     /db_xref="dbSNP:398031013"
     variation       2405
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201901446"
     variation       2406..2407
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1555571495"
     variation       2406..2407
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aacaa"
                     /db_xref="dbSNP:1555571496"
     variation       2406
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:1555571494"
     variation       2406
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:551446310"
     variation       2407..2408
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:575037869"
     variation       2407
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:201572572"
     variation       2407
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:796515393"
     variation       2408
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3209120"
     variation       2413
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1264330844"
     variation       2414..2417
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aaca"
                     /db_xref="dbSNP:1285439792"
     variation       2414..2415
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:976379703"
     variation       2414
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:923496110"
     variation       2415..2421
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="acaca"
                     /replace="acacaca"
                     /replace="acacacaca"
                     /db_xref="dbSNP:967786066"
     variation       2415
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aaca"
                     /db_xref="dbSNP:1555571483"
     variation       2415
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:568696453"
     variation       2416
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1381296634"
     variation       2416
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1242922953"
     variation       2416
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548782643"
     variation       2417
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1316656577"
     variation       2419..2429
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="acaaaa"
                     /replace="acaaaacaaaa"
                     /db_xref="dbSNP:1442760457"
     variation       2421..2424
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1483947116"
     variation       2425
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1183744712"
     variation       2428
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020720602"
     variation       2437..2443
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="aa"
                     /replace="aaaagaa"
                     /db_xref="dbSNP:752361093"
     variation       2444
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1294918681"
     variation       2446
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1408482286"
     variation       2448
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1418240665"
     variation       2449..2450
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1157213963"
     variation       2451
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:973675289"
     variation       2454
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1009370366"
     variation       2464
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1336216845"
     variation       2476
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:960544858"
     variation       2487
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:978660984"
     variation       2489
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381612365"
     variation       2497
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:962439117"
     variation       2500
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1280596115"
     variation       2501
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:529125953"
     variation       2505
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1222352977"
     variation       2516
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1002108724"
     variation       2526
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:560399952"
     variation       2527
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866964250"
     variation       2530
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1262011874"
     variation       2535
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459561137"
     variation       2537
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951048440"
     variation       2540
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405116339"
     variation       2541
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1233331053"
     variation       2543
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1174134341"
     variation       2563
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463435802"
     variation       2564
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1030481712"
     variation       2568
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1022959218"
     variation       2570
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997687342"
     variation       2571
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1169125351"
     variation       2576
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183140947"
     variation       2577..2580
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:35992798"
     variation       2580
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1047814736"
     variation       2582
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929452184"
     variation       2592
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467194776"
     variation       2593..2605
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tgttaattttttt"
                     /db_xref="dbSNP:1040970423"
     variation       2599..2611
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="ttttttttttt"
                     /replace="tttttttttttt"
                     /replace="ttttttttttttt"
                     /replace="tttttttttttttt"
                     /db_xref="dbSNP:59034311"
     variation       2599
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1330147545"
     variation       2600
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:902001912"
     variation       2612
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1346510700"
     variation       2614
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461116499"
     variation       2617
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1223784509"
     variation       2621
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1282193301"
     variation       2629
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774306822"
     variation       2631
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768452774"
     polyA_site      2638
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     variation       2645
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001273033"
     variation       2646
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1481239034"
     variation       2653
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903878933"
     variation       2662
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1270817693"
     variation       2688
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946374543"
     variation       2690
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:913627726"
     variation       2698
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1225249717"
     variation       2703
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:556635462"
     variation       2724
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042683582"
     variation       2743..2744
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1476508938"
     variation       2767
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945283137"
     variation       2768
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:960470057"
     variation       2770
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1245567520"
     variation       2772
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1034847989"
     variation       2780
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:896422662"
     variation       2787
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:527677909"
     variation       2789
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:535935117"
     variation       2791
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1380911108"
     variation       2798
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432431503"
     variation       2799
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270309265"
     variation       2807
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:981047533"
     variation       2813
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1212755937"
     variation       2814
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1293777849"
     variation       2815
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1359890603"
     variation       2819
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221550664"
     variation       2823
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:969330114"
     variation       2828
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1334428012"
     variation       2834
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1241629516"
     variation       2835..2845
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="tg"
                     /replace="tgtcctccctg"
                     /db_xref="dbSNP:1397035963"
     variation       2836
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937853846"
     variation       2839
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145386680"
     variation       2841
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1386333270"
     variation       2847
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1424580546"
     variation       2857
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297548419"
     variation       2858
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1459980916"
     variation       2859
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1162128235"
     variation       2860
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386591655"
     variation       2867
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163709382"
     variation       2883
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1006148452"
     variation       2885
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:887796694"
     variation       2886
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1325359629"
     variation       2887
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1427954982"
     variation       2888
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026296647"
     variation       2891
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1383506634"
     variation       2898
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1443605907"
     variation       2905
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:531874228"
     variation       2909
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993529456"
     variation       2928..2933
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:1445358431"
     variation       2933
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:973888146"
     variation       2934
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:941012352"
     variation       2938
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383062186"
     variation       2961
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1184423572"
     variation       2963
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1444604568"
     variation       2980
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1420054557"
     variation       2989
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:116782699"
     variation       2998
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:74441281"
     variation       3003
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044384839"
     variation       3004
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:946343523"
     variation       3012
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1455301779"
     regulatory      3014..3019
                     /regulatory_class="polyA_signal_sequence"
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
     variation       3015
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:950958016"
     variation       3017
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1338187205"
     variation       3022
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406140312"
     variation       3024
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1451871368"
     variation       3033
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:913554405"
     polyA_site      3036
                     /gene="SPOP"
                     /gene_synonym="BTBD32; TEF2"
ORIGIN      
ggggaggaggccgcgcggggtggggtctggcggtacgcgctggctgcgtcgacgtgctgacgccatgacgccccggctggtgtgtgtcggtgtgtatgtgtgtgtgtgagtgtgcgcgctccgagtgtgtgtgtatttgtgtatcggcggtcccgcaggtcccggatgttgcggacagtatgaggcaagcgcagggggacggggaccagcagctgtcgccgccgctctcagatcgagtcttgctctgtcacccaggctggagtgcagtggcgcgatctcagctcactgccacctttgcctcctgggttcaagcgattcttctgcctcagcctcccgagtagctgggattacagggtgaagagggaacagaaatctttgccccctgactttggaaatctcgtttaaccttcaaactggcgatgtcaagggttccaagtcctccacctccggcagaaatgtcgagtggccccgtagctgagagttggtgctacacacagatcaaggtagtgaaattctcctacatgtggaccatcaataactttagcttttgccgggaggaaatgggtgaagtcattaaaagttctacattttcatcaggagcaaatgataaactgaaatggtgtttgcgagtaaaccccaaagggttagatgaagaaagcaaagattacctgtcactttacctgttactggtcagctgtccaaagagtgaagttcgggcaaaattcaaattctccatcctgaatgccaagggagaagaaaccaaagctatggagagtcaacgggcatataggtttgtgcaaggcaaagactggggattcaagaaattcatccgtagagattttcttttggatgaggccaacgggcttctccctgatgacaagcttaccctcttctgcgaggtgagtgttgtgcaagattctgtcaacatttctggccagaataccatgaacatggtaaaggttcctgagtgccggctggcagatgagttaggaggactgtgggagaattcccggttcacagactgctgcttgtgtgttgccggccaggaattccaggctcacaaggctatcttagcagctcgttctccggtttttagtgccatgtttgaacatgaaatggaggagagcaaaaagaatcgagttgaaatcaatgatgtggagcctgaagtttttaaggaaatgatgtgcttcatttacacggggaaggctccaaacctcgacaaaatggctgatgatttgctggcagctgctgacaagtatgccctggagcgcttaaaggtcatgtgtgaggatgccctctgcagtaacctgtccgtggagaacgctgcagaaattctcatcctggccgacctccacagtgcagatcagttgaaaactcaggcagtggatttcatcaactatcatgcttcggatgtcttggagacctctgggtggaagtcaatggtggtgtcacatccccacttggtggctgaggcataccgctctctggcttcagcacagtgcccttttctgggacccccacgcaaacgcctgaagcaatcctaagatcctgcttgttgtaagactccgtttaatttccagaagcagcagccactgttgctgccactgaccaccaggtagacagcgcaatctgtggagcttttactctgttgtgaggggaagagactgcattgtggccccagacttttaaaacagcactaaataacttgggggaaacggggggagggaaaatgaaatgaaaaccctgttgctgcgtcactgtgttccctttggcctggctgagtttgatactgtggggattcagtttaggcgctggcccgaggatatcccagcggtggtacttcggagacacctgtctgcatctgactgagcagaacaaatcgtcaggtgcctggagcaaaaaggaaaaaaaaaaaagaaaggacattgagttttaacagaagggaaaaggaaagaagaaaagatttttgcagaatttctcaaaaatcagtttgtggattccagtagtatttatattgagagaaacaaattttagtccttctaactgtgctaaaacttggatatttgtgaaaactccttaccaccatacaagcatcagaagagctctcttgttgttagcacttattgtttgcaagaacagaatacatccttttatccttttatgaaaaatgacaagtgaaggcaaaaggggaaggttatttgatctggaagatgagtgttctgatgtggtggcttttgcaaaaatctttattggtgttgaaaactggaaaaaataactcatccagaattcatattgtcttgacaagaactatggttctctgtttttagatattgtggaaaatgtttttgggcatttttctctgattttatttcttctcccccacccctttttctaaaaaacaaacaaaaaaaaaaacacacaaaacaaaaacagaacaaaagaagagagaaggaaattttatcaattaaaaatgctgtgtgataaaatcccagcccagattgctcagctgtttgtacctgacttgccgcctgcataggagccagttctgttccttctgactagcccctcttcctccaggggagaacttccaaatgttaatttttttttttttgaaaatataaataattactattttgtactgtgtggtatctctggtcttttgtttcactcacctgccttgtctcttgggtctgagtcccttgcttaagggattttgaagtcctagttttcagcttgcagagattatgtctgaaatgcctaatgagtcgcagggatttgttgagactccgtaatctcaagttctctttgtgagctatcagcatctgccagtctcttgtcctccctgagtatctcacagtccatatcctgatgagggatcaggcccctacctctgccaaggcaagtaatggtagtgggcttttaaactgccccccgtatgttttaagacctaatccccacctcccttcttctaactaaatataaaaagatccaggggacataaatgtggagattaaataaagggaaattattgtctctaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]