GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 00:01:45, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_002585               7087 bp    mRNA    linear   PRI 30-AUG-2020
DEFINITION  Homo sapiens PBX homeobox 1 (PBX1), transcript variant 1, mRNA.
ACCESSION   NM_002585
VERSION     NM_002585.4
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 7087)
  AUTHORS   Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall
            R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG,
            Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF,
            Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC,
            Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A,
            Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG,
            Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S,
            Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A,
            Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van
            Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S,
            Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli
            D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V,
            Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X,
            Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S,
            Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood
            MA.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   2  (bases 1 to 7087)
  AUTHORS   Ji D, Zhang P, Ma W, Fei Y, Xue W, Wang Y, Zhang X, Zhou H and Zhao
            Y.
  TITLE     Oncogenic heterogeneous nuclear ribonucleoprotein D-like modulates
            the growth and imatinib response of human chronic myeloid leukemia
            CD34(+) cells via pre-B-cell leukemia homeobox 1
  JOURNAL   Oncogene 39 (2), 443-453 (2020)
   PUBMED   31488872
  REMARK    GeneRIF: HNRPDL transforms hematopoietic cells and a novel
            HNRPDL/PBX1 axis plays an important role in human CML CD34(+) cells
REFERENCE   3  (bases 1 to 7087)
  AUTHORS   Liu F, Shi J, Zhang Y, Lian A, Han X, Zuo K, Liu M, Zheng T, Zou F,
            Liu X, Jin M, Mu Y, Li G, Su G and Liu J.
  TITLE     NANOG Attenuates Hair Follicle-Derived Mesenchymal Stem Cell
            Senescence by Upregulating PBX1 and Activating AKT Signaling
  JOURNAL   Oxid Med Cell Longev 2019, 4286213 (2019)
   PUBMED   31885790
  REMARK    GeneRIF: Findings show that NANOG delays HF-MSC senescence by
            upregulating PBX1 and activating AKT signaling and that a feedback
            loop likely exists between PBX1 and AKT signaling.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 7087)
  AUTHORS   Eudy AM, Voora D, Myers RA and Clowse MEB.
  TITLE     Effect of aspirin response signature gene expression on preterm
            birth and preeclampsia among women with lupus: a pilot study
  JOURNAL   Lupus 28 (14), 1640-1647 (2019)
   PUBMED   31684818
  REMARK    GeneRIF: Expression of PBX1 and MMD was higher in the second
            trimester among lupus patients who experienced a poor pregnancy
            outcome compared to those who did not.  The pilot study identified
            two candidate genes that are reflective of the platelet function
            response to aspirin.
REFERENCE   5  (bases 1 to 7087)
  AUTHORS   Jiang Y, Liu F, Zou F, Zhang Y, Wang B, Zhang Y, Lian A, Han X, Liu
            Z, Liu X, Jin M, Wang D, Li G and Liu J.
  TITLE     PBX homeobox 1 enhances hair follicle mesenchymal stem cell
            proliferation and reprogramming through activation of the
            AKT/glycogen synthase kinase signaling pathway and suppression of
            apoptosis
  JOURNAL   Stem Cell Res Ther 10 (1), 268 (2019)
   PUBMED   31443676
  REMARK    GeneRIF: PBX1 activated the NANOG promoter, upregulated NANOG
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 7087)
  AUTHORS   Lu Q, Wright DD and Kamps MP.
  TITLE     Fusion with E2A converts the Pbx1 homeodomain protein into a
            constitutive transcriptional activator in human leukemias carrying
            the t(1;19) translocation
  JOURNAL   Mol. Cell. Biol. 14 (6), 3938-3948 (1994)
   PUBMED   7910944
REFERENCE   7  (bases 1 to 7087)
  AUTHORS   Monica K, Galili N, Nourse J, Saltman D and Cleary ML.
  TITLE     PBX2 and PBX3, new homeobox genes with extensive homology to the
            human proto-oncogene PBX1
  JOURNAL   Mol. Cell. Biol. 11 (12), 6149-6157 (1991)
   PUBMED   1682799
REFERENCE   8  (bases 1 to 7087)
  AUTHORS   Hunger SP, Galili N, Carroll AJ, Crist WM, Link MP and Cleary ML.
  TITLE     The t(1;19)(q23;p13) results in consistent fusion of E2A and PBX1
            coding sequences in acute lymphoblastic leukemias
  JOURNAL   Blood 77 (4), 687-693 (1991)
   PUBMED   1671560
REFERENCE   9  (bases 1 to 7087)
  AUTHORS   Kamps MP, Murre C, Sun XH and Baltimore D.
  TITLE     A new homeobox gene contributes the DNA binding domain of the
            t(1;19) translocation protein in pre-B ALL
  JOURNAL   Cell 60 (4), 547-555 (1990)
   PUBMED   1967983
REFERENCE   10 (bases 1 to 7087)
  AUTHORS   Nourse J, Mellentin JD, Galili N, Wilkinson J, Stanbridge E, Smith
            SD and Cleary ML.
  TITLE     Chromosomal translocation t(1;19) results in synthesis of a
            homeobox fusion mRNA that codes for a potential chimeric
            transcription factor
  JOURNAL   Cell 60 (4), 535-545 (1990)
   PUBMED   1967982
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL359255.12, DB270853.1,
            DA760179.1, BC101578.1, AK291415.1, BX647313.1, DA483403.1,
            AK022962.1, AL390119.25 and AL049381.1.
            On Aug 31, 2019 this sequence version replaced NM_002585.3.
            
            Summary: This gene encodes a nuclear protein that belongs to the
            PBX homeobox family of transcriptional factors. Studies in mice
            suggest that this gene may be involved in the regulation of
            osteogenesis and required for skeletal patterning and programming.
            A chromosomal translocation, t(1;19) involving this gene and
            TCF3/E2A gene, is associated with pre-B-cell acute lymphoblastic
            leukemia. The resulting fusion protein, in which the DNA binding
            domain of E2A is replaced by the DNA binding domain of this
            protein, transforms cells by constitutively activating
            transcription of genes regulated by the PBX protein family.
            Alternatively spliced transcript variants encoding different
            isoforms have been found for this gene. [provided by RefSeq, Jun
            2017].
            
            Transcript Variant: This variant (1) represents the predominant
            transcript and encodes the longest isoform (1, also known as
            isoform PBX1a).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK291415.1, M86546.1 [ECO:0000332]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000420696.7/ ENSP00000405890.2
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-176               AL359255.12        7160-7335
            177-449             DB270853.1         2-274
            450-450             AL359255.12        7609-7609
            451-767             DA760179.1         235-551
            768-1962            BC101578.1         181-1375
            1963-2249           AK291415.1         1469-1755
            2250-2744           BX647313.1         2670-3164
            2745-3054           DA483403.1         338-647
            3055-3499           BX647313.1         3475-3919
            3500-3591           AK022962.1         506-597
            3592-4925           BX647313.1         4012-5345
            4926-7041           AL390119.25        14712-16827
            7042-7086           AL049381.1         2226-2270
            7087-7087           AL390119.25        16873-16873
FEATURES             Location/Qualifiers
     source          1..7087
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q23.3"
     gene            1..7087
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="PBX homeobox 1"
                     /db_xref="GeneID:5087"
                     /db_xref="HGNC:HGNC:8632"
                     /db_xref="MIM:176310"
     exon            1..830
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       11..16
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="agg"
                     /replace="aggagg"
                     /db_xref="dbSNP:1268626277"
     variation       13
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1220726012"
     variation       15
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484126440"
     variation       24
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1275651970"
     variation       47
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1023409843"
     variation       48
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1158261583"
     variation       56
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1026548158"
     variation       58
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1303560499"
     variation       59
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:969099986"
     variation       60
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344877922"
     variation       67
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1281061004"
     variation       77
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:979579734"
     variation       78
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571215586"
     variation       80
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1345779045"
     variation       81
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:530704049"
     variation       86
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:984975180"
     variation       87
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1307059016"
     variation       88..92
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:1460198659"
     variation       88
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:544145822"
     variation       91
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:959457409"
     variation       95
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:988106833"
     variation       102
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1473794914"
     variation       106
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1253041956"
     variation       107
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1176811811"
     variation       110
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:912443126"
     variation       116
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:990838015"
     variation       118
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1452950348"
     variation       120
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:879536890"
     variation       128
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1370507641"
     variation       131
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571215689"
     variation       133
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571215698"
     variation       139
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1261196851"
     variation       140
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1222764102"
     variation       143
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229955744"
     variation       145
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1329580290"
     variation       146..174
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gggggtgggggg"
                     /replace="gggggtggggggcagcggggggtgggggg"
                     /db_xref="dbSNP:1306098940"
     variation       148
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1046091602"
     variation       151
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1380901272"
     variation       152..157
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gggggg"
                     /replace="ggggggg"
                     /db_xref="dbSNP:924542758"
     variation       152
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1451308687"
     variation       154
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1210910849"
     variation       156
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1174865565"
     variation       157
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:560699937"
     variation       159
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1413142090"
     variation       160
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1054295743"
     variation       161
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1258548384"
     variation       162..167
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gggggg"
                     /replace="ggggggg"
                     /db_xref="dbSNP:1188469628"
     variation       163
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:892939314"
     variation       164
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1007328886"
     variation       165
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1241401372"
     variation       166
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1038778941"
     variation       168
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1212017827"
     variation       169..176
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ggggggg"
                     /replace="gggggggg"
                     /replace="ggggggggg"
                     /db_xref="dbSNP:1283135948"
     variation       169
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1239485668"
     variation       170
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:901531365"
     variation       171
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1437892122"
     variation       173
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:975360358"
     variation       174
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:921360195"
     variation       177..179
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1027022131"
     variation       177
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1473542645"
     variation       178
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1444288378"
     variation       179
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:931439780"
     variation       186
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1048956467"
     variation       190
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1465246657"
     variation       192
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006850756"
     variation       193
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203120637"
     variation       194
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:529848541"
     variation       196
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265864592"
     variation       197
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:940151447"
     variation       200
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057381999"
     variation       201
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1299086686"
     variation       203
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1335762121"
     variation       220
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:549032032"
     variation       223
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1327482046"
     variation       224
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1295536997"
     variation       225
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1440742620"
     variation       226
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393297900"
     variation       236
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1013273240"
     variation       237
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1279644646"
     variation       244..262
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttaagc"
                     /replace="ttaagccacagatttaagc"
                     /db_xref="dbSNP:1424183527"
     variation       246
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363960826"
     variation       247
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1351587945"
     variation       250..253
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ca"
                     /replace="caca"
                     /db_xref="dbSNP:990890460"
     variation       256..258
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1230807591"
     variation       257
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571216101"
     variation       258
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190912981"
     variation       261
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1023337517"
     variation       263
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1434898335"
     variation       270
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1281974824"
     variation       272
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1221466007"
     variation       283
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1323251248"
     variation       296
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:904839999"
     variation       300
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1205203050"
     variation       303
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:566185041"
     variation       314
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1000659283"
     variation       315
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1249162537"
     variation       318
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:528605335"
     variation       328
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:978112691"
     variation       332
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:923897403"
     variation       336
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1404746017"
     variation       338
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:934601384"
     variation       339
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:956572516"
     variation       341..343
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:990443626"
     variation       343
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:551744085"
     variation       344
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1410793409"
     variation       348
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571216277"
     variation       350
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1203840724"
     variation       359
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:571599502"
     variation       364
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1166292218"
     variation       374
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1467458855"
     variation       375
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252661812"
     variation       378
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571216326"
     variation       379
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484097973"
     variation       381
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1479351503"
     variation       382
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:988341055"
     variation       386
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:914427001"
     variation       388
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1019508589"
     variation       390
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:965237181"
     variation       391
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:943164278"
     variation       392
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428581091"
     variation       394
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1478229346"
     variation       395
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1201689929"
     variation       405
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1174108601"
     variation       406..408
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1347696303"
     variation       409
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1416875420"
     variation       410
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571216412"
     variation       411
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:905188435"
     variation       412
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1321830701"
     variation       416
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1328900669"
     variation       418
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1371835779"
     variation       419
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571216454"
     variation       420
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290665900"
     variation       421
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1038830927"
     variation       423
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1335401175"
     variation       424
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1001431783"
     variation       426
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1301823861"
     variation       427
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1345514019"
     variation       430..449
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ccccctccccctccccctcc"
                     /replace="ccccctccccctccccctccccctcc"
                     /db_xref="dbSNP:1406674809"
     variation       430..434
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1557859402"
     variation       430
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175578306"
     variation       432
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1234341788"
     variation       434
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1413886501"
     variation       435
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1035559913"
     variation       436..440
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1469258703"
     variation       436
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1337643935"
     variation       437
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:537693783"
     variation       440
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1557859444"
     variation       441
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:895711115"
     variation       444
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1461356290"
     variation       445..451
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="cctcctc"
                     /db_xref="dbSNP:1344387426"
     variation       447..453
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="tcctcat"
                     /db_xref="dbSNP:1220435094"
     variation       447
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1268009207"
     variation       448
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460426026"
     variation       450
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12033962"
     variation       451
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:567829083"
     variation       452
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1200671976"
     variation       453
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240174188"
     variation       454..455
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cc"
                     /replace="ccccccccc"
                     /db_xref="dbSNP:1557859494"
     variation       455
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:933027175"
     variation       456
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1168816376"
     variation       460
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1391697384"
     variation       463
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1422212039"
     variation       469
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377078800"
     variation       480
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1450349887"
     variation       484
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571216803"
     variation       485..494
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttttttttt"
                     /replace="tttttttttt"
                     /replace="ttttttttttt"
                     /db_xref="dbSNP:1318672701"
     variation       486
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1390577277"
     variation       488
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886076794"
     variation       490
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1006494238"
     variation       495
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325901487"
     variation       498
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:553321747"
     variation       500..506
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="ggtcttc"
                     /db_xref="dbSNP:1325022287"
     variation       500
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1430531046"
     variation       501
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1298598861"
     variation       503
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1344586193"
     variation       506
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1243794464"
     variation       507..512
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tttttt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:1443258048"
     variation       509
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1244355681"
     variation       512
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1216897563"
     variation       513
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:975286908"
     variation       515
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1224989935"
     variation       516
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1557859583"
     variation       517
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020498395"
     variation       520
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:572881937"
     variation       523
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1360519814"
     variation       525
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356913441"
     variation       528
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571216998"
     variation       530
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1243901349"
     variation       533
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1367222920"
     variation       539
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270664274"
     variation       548
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571217019"
     variation       555
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:895348857"
     variation       563..567
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1211533834"
     variation       576
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1325360427"
     variation       577
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1282124177"
     variation       580
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012363761"
     variation       585..597
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gagccgag"
                     /replace="gagccgagccgag"
                     /replace="gagccgagccgagccgag"
                     /db_xref="dbSNP:970787385"
     variation       587
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1446202470"
     variation       589
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755790509"
     variation       590
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:544814565"
     variation       594
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1421545656"
     variation       595
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1475407668"
     variation       596
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1240713863"
     variation       599..603
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ag"
                     /replace="agcag"
                     /db_xref="dbSNP:1311159937"
     variation       600
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354987293"
     variation       601
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1184121949"
     variation       603
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1415624530"
     variation       606
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1315175848"
     variation       608
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:558520686"
     variation       609
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238836294"
     variation       611
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1261788379"
     variation       616
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:921304480"
     variation       617..621
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:1557859728"
     variation       618
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1364129043"
     variation       621
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1208024685"
     variation       627
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770433143"
     misc_feature    628..630
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="upstream in-frame stop codon"
     variation       628
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:931299581"
     variation       629
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1183221185"
     variation       631
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:187406949"
     variation       632
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1557859760"
     variation       633..635
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:779217453"
     variation       633
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1418254816"
     variation       637
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1182294962"
     CDS             640..1932
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="isoform 1 is encoded by transcript variant 1;
                     pre-B-cell leukemia transcription factor 1; pre-B-cell
                     leukemia homeobox 1; homeobox protein PRL; homeobox
                     protein PBX1"
                     /codon_start=1
                     /product="pre-B-cell leukemia transcription factor 1
                     isoform 1"
                     /protein_id="NP_002576.1"
                     /db_xref="CCDS:CCDS1246.1"
                     /db_xref="GeneID:5087"
                     /db_xref="HGNC:HGNC:8632"
                     /db_xref="MIM:176310"
                     /translation="
MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSN"
     misc_feature    757..1335
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="PBC domain; Region: PBC; pfam03792"
                     /db_xref="CDD:309062"
     misc_feature    901..906
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="Breakpoint for translocation to form TCF3-PBX1
                     oncogene; propagated from UniProtKB/Swiss-Prot (P40424.1);
                     other site"
     misc_feature    1339..1521
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(1339..1353,1357..1359,1417..1419,1435..1437,
                     1474..1476,1480..1485,1492..1497,1501..1509,1513..1518)
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(1345..1347,1354..1356,1483..1485,1492..1497,
                     1504..1506)
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     variation       648
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375925928"
     variation       651
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1031011831"
     variation       657
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1344429665"
     variation       661
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:958254448"
     variation       669
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:940224282"
     variation       670
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435469620"
     variation       671
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:747490519"
     variation       677
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304780734"
     variation       683
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1431301757"
     variation       689
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769041303"
     variation       690
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057295149"
     variation       691
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:544057798"
     variation       692
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379669919"
     variation       694
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765608918"
     variation       695
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:773577978"
     variation       696
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763090532"
     variation       697
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1211667432"
     variation       698
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1249217854"
     variation       699
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1480117986"
     variation       700
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2275558"
     variation       702
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1239772111"
     variation       703
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436664266"
     variation       710
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751494699"
     variation       715
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1418007558"
     variation       717
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372558581"
     variation       722
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1480951245"
     variation       726
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1044664177"
     variation       729
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1450777247"
     variation       730
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1192905716"
     variation       731
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:192264696"
     variation       734
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1433807647"
     variation       736
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1178355813"
     variation       738
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1000903065"
     variation       742
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1305643442"
     variation       743
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1461673861"
     variation       749
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1299022900"
     variation       750
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1402888460"
     variation       752
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370561885"
     variation       755
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1325785503"
     variation       765
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144593424"
     variation       773
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:777341799"
     variation       777
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292838914"
     variation       784
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571217834"
     variation       791
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111531180"
     variation       809
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306484700"
     variation       810
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:933098068"
     variation       817
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:866899815"
     variation       822
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1227689671"
     variation       825
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1281207783"
     variation       826
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148894677"
     exon            831..904
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       831
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148071998"
     variation       837
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753464149"
     variation       842
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200380618"
     variation       843
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:930969908"
     variation       845
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571224461"
     variation       846
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756942265"
     variation       861
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167743695"
     variation       863
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369144775"
     variation       874
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:749957295"
     variation       879
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571224510"
     variation       891
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757935208"
     variation       895
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138090483"
     variation       896..901
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /db_xref="dbSNP:1299516122"
     exon            905..1149
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       916
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1423937629"
     variation       917
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1481766438"
     variation       920
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35543782"
     variation       928
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867567117"
     variation       944
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1466947651"
     variation       954
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1162544117"
     variation       964
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757647151"
     variation       966
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032513241"
     variation       975
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:957073199"
     variation       981
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778963772"
     variation       987
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200580172"
     variation       991
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1332887753"
     variation       996
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772022038"
     variation       1002
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147201088"
     variation       1004
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775678833"
     variation       1005
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1318898046"
     variation       1008
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746943837"
     variation       1009..1010
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gg"
                     /replace="gggg"
                     /db_xref="dbSNP:1571416477"
     variation       1015
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:962037824"
     variation       1016..1040
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cggcggcagcggcggc"
                     /replace="cggcggcagcggcggcagcggcggc"
                     /replace="cggcggcagcggcggcagcggcggcagcggcggc"
                     /db_xref="dbSNP:770921151"
     variation       1016
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768635810"
     variation       1017
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:912874716"
     variation       1018..1037
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gcggc"
                     /replace="gcggcagcggcggcagcggc"
                     /db_xref="dbSNP:1558010701"
     variation       1018..1028
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gcggcagcggc"
                     /replace="gcggcagcggcagcggc"
                     /db_xref="dbSNP:1558010693"
     variation       1019
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1349939044"
     variation       1020
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776560517"
     variation       1022
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210943507"
     variation       1026
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761524674"
     variation       1027
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765108033"
     variation       1028
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772720191"
     variation       1029
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762709883"
     variation       1031
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1571416623"
     variation       1031
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765806321"
     variation       1032
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751176674"
     variation       1033..1043
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gcggcggc"
                     /replace="gcggcggcggc"
                     /replace="gcggcggcggcggc"
                     /db_xref="dbSNP:774278800"
     variation       1034
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185439958"
     variation       1035
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541710796"
     variation       1037
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458267934"
     variation       1038
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558010796"
     variation       1040
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754428947"
     variation       1041
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199855181"
     variation       1051..1058
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="ggggcagg"
                     /db_xref="dbSNP:1553247020"
     variation       1052
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1454591193"
     variation       1054
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201279083"
     variation       1057
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:953834516"
     variation       1059
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746045110"
     variation       1061
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:866426234"
     variation       1066..1067
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1553247028"
     variation       1068
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758713117"
     variation       1071
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780093664"
     variation       1072
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571416832"
     variation       1074
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340224297"
     variation       1077
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246026174"
     variation       1089
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1471356577"
     variation       1090
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1286420275"
     variation       1097
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747029494"
     variation       1101
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558010879"
     variation       1107
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215179946"
     variation       1111
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1286107121"
     variation       1116
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1489019776"
     variation       1121
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1410575958"
     variation       1137
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1208255806"
     variation       1143
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143132748"
     variation       1146
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1048843231"
     exon            1150..1340
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       1152
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571430870"
     variation       1158
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781292048"
     variation       1173
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375506788"
     variation       1179
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769833066"
     variation       1186
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:953418388"
     variation       1189
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1553248081"
     variation       1197
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:556050975"
     variation       1199
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1006016890"
     variation       1203
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1329481193"
     variation       1209
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749046771"
     variation       1215
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:770880553"
     variation       1218
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1411390288"
     variation       1219
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774100520"
     variation       1221
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759313222"
     variation       1234
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771675680"
     variation       1235
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1433896828"
     variation       1241
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775205004"
     variation       1256
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1421804755"
     variation       1257
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1571431063"
     variation       1257
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1465382616"
     variation       1261
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571431073"
     variation       1262
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1171842620"
     variation       1290
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1402999260"
     variation       1293
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41266608"
     variation       1296
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765717583"
     variation       1299
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763332823"
     variation       1300
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571431145"
     variation       1305
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1388049892"
     variation       1307
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571431167"
     variation       1315
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376272015"
     variation       1319
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1553248110"
     variation       1330
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1339461106"
     variation       1337
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:868523852"
     variation       1339
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1218945005"
     variation       1340
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1553248112"
     exon            1341..1476
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       1342
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571445295"
     variation       1343
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1553249136"
     variation       1344
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1353300228"
     variation       1362
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768078814"
     variation       1368
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773717794"
     variation       1371
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190363555"
     variation       1383
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766728137"
     variation       1389
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283963117"
     variation       1401
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488036135"
     variation       1404
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751981086"
     variation       1407
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1380228771"
     variation       1416
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:897886845"
     variation       1419..1422
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1553249146"
     variation       1428
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139881410"
     variation       1440
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:982554794"
     variation       1443
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1181661841"
     variation       1449
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:767663970"
     variation       1457
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558020021"
     exon            1477..1636
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       1485
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775760222"
     variation       1501
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259895025"
     variation       1509
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908352825"
     variation       1512
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760848613"
     variation       1514
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:866844940"
     variation       1524
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1279657370"
     variation       1536
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1314271113"
     variation       1539
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764232094"
     variation       1540
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753922245"
     variation       1545
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384499111"
     variation       1558
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1458613469"
     variation       1567
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1181126074"
     variation       1572
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148808502"
     variation       1576
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558022479"
     variation       1579
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477435698"
     variation       1581
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1187713967"
     variation       1583
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546195075"
     variation       1590
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757424601"
     variation       1598
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:267598144"
     variation       1609
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765200363"
     variation       1613
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558022514"
     variation       1614
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750417622"
     variation       1617
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558022534"
     variation       1622
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1400850042"
     variation       1623
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1388777814"
     variation       1625
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1290495014"
     variation       1632
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:755845426"
     exon            1637..1749
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       1637
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1175974386"
     variation       1641
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764163292"
     variation       1643
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1480599224"
     variation       1646
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1424046891"
     variation       1649
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:905922107"
     variation       1655
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1310898359"
     variation       1657
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256887115"
     variation       1661
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776997383"
     variation       1663
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161353651"
     variation       1668
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389953853"
     variation       1673
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1212721505"
     variation       1674
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1404783312"
     variation       1677
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1324292200"
     variation       1681
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1321918768"
     variation       1683
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761944828"
     variation       1686
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765425125"
     variation       1687
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750360584"
     variation       1689
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762835624"
     variation       1692
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:548599018"
     variation       1706
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1282894507"
     variation       1708
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751257842"
     variation       1710
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:561913596"
     variation       1720
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780672150"
     variation       1725
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1293305544"
     variation       1733..1734
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:34778614"
     variation       1733
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752373773"
     variation       1736
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1372566739"
     variation       1737
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186124927"
     variation       1738
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142396283"
     variation       1741
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:906379595"
     variation       1742
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746371607"
     variation       1743
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772515409"
     variation       1746
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:780621738"
     variation       1748
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747269460"
     exon            1750..1839
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       1756
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571471422"
     variation       1760
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1339209588"
     variation       1761
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759559064"
     variation       1762
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868781414"
     variation       1763
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201963901"
     variation       1771
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775324300"
     variation       1788
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:763668406"
     variation       1790
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753557796"
     variation       1793
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1037995461"
     variation       1799
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201029742"
     variation       1800
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188237782"
     variation       1803
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143289090"
     variation       1804
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541105414"
     variation       1806
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224719160"
     variation       1807
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564455203"
     variation       1808
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748459643"
     variation       1814
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1251320270"
     variation       1815
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420999764"
     variation       1817
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1196974442"
     variation       1820
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756581427"
     variation       1826
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466818722"
     variation       1827
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:533693615"
     variation       1829
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770885352"
     variation       1831
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146653553"
     variation       1837
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745780226"
     variation       1839
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1332683363"
     exon            1840..7087
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       1840..1841
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="tttttt"
                     /db_xref="dbSNP:1219033291"
     variation       1843
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1297562435"
     variation       1845
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568447228"
     variation       1850
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768408673"
     variation       1854
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1264921684"
     variation       1871
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:776551626"
     variation       1877
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558042645"
     variation       1879
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224964185"
     variation       1884
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:761357785"
     variation       1886..1889
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:34262468"
     variation       1887
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488141897"
     variation       1891
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773697815"
     variation       1893
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1309423234"
     variation       1898
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1205686195"
     variation       1902
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369700366"
     variation       1904
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150307059"
     variation       1912
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571521020"
     variation       1913
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302539075"
     variation       1924
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112169952"
     variation       1925
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1456864262"
     variation       1926
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1196037776"
     variation       1931
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1047727511"
     variation       1936
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762505114"
     variation       1937
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766036629"
     variation       1938
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:753224889"
     variation       1943
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377526450"
     variation       1944
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1295908467"
     variation       1945
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767477540"
     variation       1946
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377334192"
     variation       1951
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760736024"
     variation       1952
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370789005"
     variation       1953
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750663535"
     variation       1956
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142359401"
     variation       1960
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:894882134"
     variation       1961
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746944161"
     variation       1963
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1057073"
     variation       1964
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012379575"
     variation       1968
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1360211856"
     variation       1969
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1169530154"
     variation       1970
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:768695909"
     variation       1972
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765064083"
     variation       1976
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1353270743"
     variation       1978
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374816345"
     variation       1979
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1462998780"
     variation       1981
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769501548"
     variation       1982
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772900634"
     variation       1983
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:946028772"
     variation       1985
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1480312469"
     variation       1995
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1256723308"
     variation       1996
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571521353"
     variation       2001
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1041811833"
     variation       2005
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:553844911"
     variation       2007
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1310996728"
     variation       2008
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3205270"
     variation       2009
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:999209978"
     variation       2011
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558042889"
     variation       2012
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866068055"
     variation       2016
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1030870918"
     variation       2017
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:955333190"
     variation       2023
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1310907240"
     variation       2025
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:986578729"
     variation       2029
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:868513084"
     variation       2031
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571521449"
     variation       2032
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867804191"
     variation       2033
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1440357469"
     variation       2039
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1195461173"
     variation       2040
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1263591115"
     variation       2043
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753807663"
     variation       2048
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:963859438"
     variation       2051
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974541042"
     variation       2052
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1558042949"
     variation       2056
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1450095735"
     variation       2058
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755254056"
     variation       2062
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1172962696"
     variation       2063..2067
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ct"
                     /replace="cttct"
                     /db_xref="dbSNP:1420041931"
     variation       2065
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381946330"
     variation       2067
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:577619691"
     variation       2070
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:920029468"
     variation       2071
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:929958137"
     variation       2080
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256914404"
     variation       2087
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12135379"
     variation       2095
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184165420"
     variation       2100
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1257379146"
     variation       2104
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:961771639"
     variation       2105
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1402060327"
     variation       2106
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1299099536"
     variation       2123
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9771"
     variation       2127..2134
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttttttt"
                     /replace="tttttttt"
                     /replace="ttttttttt"
                     /db_xref="dbSNP:554904027"
     variation       2127
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:14832"
     variation       2133
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:928852710"
     variation       2134
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:938942127"
     variation       2146
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1056069445"
     variation       2148
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1229488023"
     variation       2149
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1398552957"
     variation       2151
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:532008899"
     variation       2159
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556891907"
     variation       2165
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1400554061"
     variation       2170
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867223594"
     variation       2177
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:947584541"
     variation       2178..2181
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1558043065"
     variation       2182
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332207308"
     variation       2183
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111327965"
     variation       2186
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:188518874"
     variation       2190
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1417263388"
     variation       2191
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195014886"
     variation       2194
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:548775179"
     variation       2200
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1261446317"
     variation       2200
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542038730"
     variation       2202
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1204969574"
     variation       2205
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1233277258"
     variation       2211
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:999597455"
     variation       2212
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250986103"
     variation       2216
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1246539569"
     variation       2217
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1331956630"
     variation       2220
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292201283"
     variation       2221
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375939144"
     variation       2222
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1052073693"
     variation       2223
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373586993"
     variation       2226
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1218336298"
     variation       2227
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1008070726"
     variation       2228
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1018167326"
     variation       2230
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:964183630"
     variation       2231
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995385778"
     variation       2237
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1487807102"
     variation       2251
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1027482280"
     variation       2262
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:527366247"
     variation       2271
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758063544"
     variation       2274
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1434059737"
     variation       2283
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1269932038"
     variation       2283
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:936101494"
     variation       2285
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541039475"
     variation       2287
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1466888729"
     variation       2290
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:780054564"
     variation       2291
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1271962740"
     variation       2300
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1198670922"
     variation       2308
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1050484368"
     variation       2314..2320
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tgt"
                     /replace="tgtttgt"
                     /db_xref="dbSNP:562096001"
     variation       2316
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:951519287"
     variation       2317
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1331456791"
     variation       2322
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040637726"
     variation       2323
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1375972626"
     variation       2328
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1421653911"
     variation       2329
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:563699510"
     variation       2343
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:898033993"
     variation       2347
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1159411318"
     variation       2353
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1360134507"
     variation       2360
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:983172778"
     variation       2362
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:993197907"
     variation       2364
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752575028"
     variation       2365
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379729583"
     variation       2376
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571522183"
     variation       2378
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1197256219"
     variation       2381
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1454124002"
     variation       2388
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:533063454"
     variation       2394
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:549714267"
     variation       2397..2401
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ct"
                     /replace="cttct"
                     /db_xref="dbSNP:1386674131"
     variation       2397
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1247872756"
     variation       2400
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1195148602"
     variation       2401
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1453337752"
     variation       2409..2412
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tctt"
                     /replace="tcttctt"
                     /db_xref="dbSNP:1299902874"
     variation       2414
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1328835049"
     variation       2417
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1231746580"
     variation       2419
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1346927888"
     variation       2421
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310177319"
     variation       2422
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1449298393"
     variation       2428
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1334044991"
     variation       2434
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41266618"
     variation       2435
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1033380100"
     variation       2436
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558043309"
     variation       2444
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777912982"
     variation       2452
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1404915859"
     variation       2456
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:960533662"
     variation       2463
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1309450229"
     variation       2472
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1352573369"
     variation       2473
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867438784"
     variation       2479
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916175535"
     variation       2486
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1180535741"
     variation       2487..2491
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tc"
                     /replace="tcttc"
                     /db_xref="dbSNP:1442520970"
     variation       2487
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1258137631"
     variation       2488
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:947536189"
     variation       2492
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991912321"
     variation       2496
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:529120684"
     variation       2498..2501
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:35445188"
     variation       2500
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485189590"
     variation       2505
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286547625"
     variation       2518
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1242582450"
     variation       2522
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1348863204"
     variation       2525
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020886716"
     variation       2534
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925008063"
     variation       2541
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1245561558"
     variation       2547
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:548884046"
     variation       2551
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1209147195"
     variation       2559
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:568555769"
     variation       2563
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1441547544"
     variation       2575
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:890769206"
     variation       2584
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:925973025"
     variation       2591
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3738195"
     variation       2605
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1402060778"
     variation       2619
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1405288301"
     variation       2621
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1157670961"
     variation       2625
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115818637"
     variation       2626
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:570904135"
     variation       2628
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944859347"
     variation       2631
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040920915"
     variation       2637
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263593513"
     variation       2645
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218453832"
     variation       2646
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445097600"
     variation       2650
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039587704"
     variation       2652
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754588464"
     variation       2656
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1167222730"
     variation       2656
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:539830647"
     variation       2657
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929570688"
     variation       2659
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1291583374"
     variation       2662
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:995728529"
     variation       2663
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1049316364"
     variation       2668
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1280678226"
     variation       2681
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1429014614"
     variation       2694
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026848210"
     variation       2702
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571522749"
     variation       2705
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001788462"
     variation       2711
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558043518"
     variation       2713
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448303153"
     variation       2714
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1396031465"
     variation       2723
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1033390093"
     variation       2726
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558043527"
     variation       2732
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747856055"
     variation       2745
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6426881"
     variation       2749
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772957901"
     variation       2755
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474268783"
     variation       2757
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749671886"
     variation       2759
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1013431736"
     variation       2761
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1221689739"
     variation       2766..2767
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ta"
                     /replace="taaaata"
                     /db_xref="dbSNP:1271325952"
     variation       2768
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1021237702"
     variation       2774
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1035778123"
     variation       2778
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147638800"
     variation       2794
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1213339472"
     variation       2798
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1361681709"
     variation       2799
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1275884827"
     variation       2801
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1436716729"
     variation       2802
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372789435"
     variation       2803
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142283079"
     variation       2808
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368405625"
     variation       2812
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1460404391"
     variation       2818
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1400403828"
     variation       2836
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991523866"
     variation       2838
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172425755"
     variation       2841
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:916148850"
     variation       2852
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1172993609"
     variation       2871
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:969023069"
     variation       2872
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571523044"
     variation       2875..2882
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="acacac"
                     /replace="acacacac"
                     /db_xref="dbSNP:1491151856"
     variation       2876
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1491273073"
     variation       2876
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:986090968"
     variation       2878
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458224102"
     variation       2880
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1240166890"
     variation       2882
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263561545"
     variation       2883
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:979326659"
     variation       2884..2885
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:796099230"
     variation       2887
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1221247789"
     variation       2892
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:976173382"
     variation       2894
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:919457856"
     variation       2904
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1376983142"
     variation       2905
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:924775231"
     variation       2915
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:934843287"
     variation       2916
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459050694"
     variation       2919
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:987811573"
     variation       2926
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1199244377"
     variation       2930
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:912345250"
     variation       2931
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145716228"
     variation       2936
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1183803783"
     variation       2946
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1039367384"
     variation       2947
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:899734511"
     variation       2951
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1173234917"
     variation       2954
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1440621074"
     variation       2955
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1410217542"
     variation       2957
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1423536000"
     variation       2959
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184230234"
     variation       2970
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:931214301"
     variation       2973
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571523277"
     variation       2974
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1480363301"
     variation       2975
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:3185695"
     variation       2981
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886905745"
     variation       2987
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1213656170"
     variation       2988
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:563837840"
     variation       2996
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1280146312"
     variation       3006..3009
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1233070122"
     variation       3008
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1354031336"
     variation       3010
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774976931"
     variation       3018
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1426354109"
     variation       3020
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1035770173"
     variation       3025..3029
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aca"
                     /replace="acaca"
                     /db_xref="dbSNP:1466584111"
     variation       3029
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:895945449"
     variation       3032
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1303301200"
     variation       3036
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1416605442"
     variation       3040
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373389510"
     variation       3047
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937695219"
     variation       3062
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147776492"
     variation       3064
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1439406115"
     variation       3065
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012905821"
     variation       3068
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304150355"
     variation       3071
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1157239613"
     variation       3073
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1418517659"
     variation       3077
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759956201"
     variation       3078
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:539466769"
     variation       3087
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896144719"
     variation       3090
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1013777866"
     variation       3094
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1157591136"
     variation       3098
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1291184390"
     variation       3100
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1487071775"
     variation       3111
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1262051750"
     variation       3124
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1213234014"
     variation       3126
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141192050"
     variation       3128
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042139634"
     variation       3133
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558043870"
     variation       3136
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:542999210"
     variation       3137
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1353543408"
     variation       3150
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1316082136"
     variation       3156
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1032343769"
     variation       3158
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386883656"
     variation       3175
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1287316540"
     variation       3184
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1453396214"
     variation       3185
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767675289"
     variation       3188
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775524622"
     variation       3190
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350505328"
     variation       3198
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167249833"
     variation       3201
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459961555"
     variation       3228
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571523657"
     variation       3244
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760694683"
     variation       3245
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1195039306"
     variation       3248
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:6683162"
     variation       3260
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1184401946"
     variation       3263
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1485363876"
     variation       3266
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1180391417"
     variation       3268
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:975145244"
     variation       3269..3272
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tgtt"
                     /replace="tgttgtt"
                     /db_xref="dbSNP:1273250804"
     variation       3273
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558043940"
     variation       3290
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181970491"
     variation       3291
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1007579477"
     variation       3298
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1170582364"
     variation       3302
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1272401889"
     variation       3308
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143488511"
     variation       3311
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:920916158"
     variation       3323
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1017640639"
     variation       3327
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:966068436"
     variation       3330
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1381837178"
     variation       3332
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930974965"
     variation       3333
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79721421"
     variation       3340
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:919314962"
     variation       3341
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1393848447"
     variation       3342
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1171995624"
     variation       3344
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1464041294"
     variation       3350
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1407669931"
     variation       3365..3369
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ga"
                     /replace="gagga"
                     /db_xref="dbSNP:1371669183"
     variation       3366..3388
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="aggacctgagaatcatggggaaa"
                     /db_xref="dbSNP:781642115"
     variation       3369
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1177646131"
     variation       3372
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1434143919"
     variation       3372
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:528286032"
     variation       3373
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195117268"
     variation       3380
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1466737398"
     variation       3388
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:939834124"
     variation       3397
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196269960"
     variation       3399
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459101386"
     variation       3406
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375028098"
     variation       3432
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:909480204"
     variation       3446
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571523981"
     variation       3448
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751559967"
     variation       3469
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1277420235"
     variation       3475
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:938294188"
     variation       3480
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1439058903"
     variation       3481
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1370334468"
     variation       3489
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1055286998"
     variation       3491
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524050"
     variation       3501
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1393625136"
     variation       3502
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754853159"
     variation       3504
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298139881"
     variation       3505
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369440305"
     variation       3506
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397290507"
     variation       3520
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1023490847"
     variation       3523
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1311724845"
     variation       3531
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1128595"
     variation       3532
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175120316"
     variation       3537
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1208979749"
     variation       3539
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:539866852"
     variation       3552
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1288502448"
     variation       3559..3562
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="atca"
                     /replace="atcaatca"
                     /db_xref="dbSNP:1042542482"
     variation       3559
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1181837907"
     variation       3561
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1000614723"
     variation       3578
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868081472"
     variation       3582
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1031918658"
     variation       3583
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1001125741"
     variation       3586
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1488790981"
     variation       3588
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1128596"
     variation       3593
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1485868102"
     variation       3594
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1282288804"
     variation       3595
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781230082"
     variation       3602
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1394391502"
     variation       3624
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524237"
     variation       3625
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347492147"
     variation       3634
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:987584485"
     variation       3639
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1053589903"
     variation       3642
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1334066436"
     variation       3653
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:550169170"
     variation       3655
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1416003328"
     variation       3679
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006849755"
     variation       3682
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:964866998"
     variation       3686
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1019533707"
     variation       3690..3691
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="at"
                     /replace="atat"
                     /db_xref="dbSNP:1434508850"
     variation       3690
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:975150580"
     variation       3692
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1479273696"
     variation       3694
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1192337232"
     variation       3697
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1361618921"
     variation       3698
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:41266620"
     variation       3701
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568818969"
     variation       3702
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:537699693"
     variation       3705
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1362079400"
     variation       3706
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:950800311"
     variation       3711
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1207136710"
     variation       3712
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1348617477"
     variation       3718
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:908441792"
     variation       3725
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1016412100"
     variation       3734
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:554844532"
     variation       3735
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:991067355"
     variation       3736
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1057084331"
     variation       3739
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:918144489"
     variation       3741
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:949075197"
     variation       3746
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382103342"
     variation       3754
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:977762725"
     variation       3755
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148020619"
     variation       3757
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948539129"
     variation       3758
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1461530356"
     variation       3761
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1044453930"
     variation       3763
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1275421805"
     variation       3764
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1242550224"
     variation       3765
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1366986699"
     variation       3770..3776
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttgt"
                     /replace="ttgttgt"
                     /db_xref="dbSNP:936463399"
     variation       3772
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1053529629"
     variation       3775
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779658878"
     variation       3782
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1000180944"
     variation       3783
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889656845"
     variation       3785
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1053555891"
     variation       3787
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1340492498"
     variation       3794
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354731746"
     variation       3803
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1432431769"
     variation       3807
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1324272984"
     variation       3812
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:891808265"
     variation       3813
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1440922179"
     variation       3814
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777578170"
     variation       3817
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1162691711"
     variation       3824
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524678"
     variation       3826
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524685"
     variation       3827
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141517830"
     variation       3834
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:964815048"
     variation       3843..3849
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tctt"
                     /replace="tcttctt"
                     /db_xref="dbSNP:1222945161"
     variation       3844
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1419933764"
     variation       3845
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1169376714"
     variation       3853
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:996782115"
     variation       3861
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1246643997"
     variation       3866
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194517497"
     variation       3869
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886418939"
     variation       3873
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006302434"
     variation       3874
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1251291557"
     variation       3878
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:572601779"
     variation       3899
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524796"
     variation       3904
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1191228942"
     variation       3913
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438949755"
     variation       3918
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:952595637"
     variation       3930
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748876013"
     variation       3937
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1213138788"
     variation       3939
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983791845"
     variation       3940
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:535214220"
     variation       3943
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1296348270"
     variation       3955
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:552480658"
     variation       3961
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1372538375"
     variation       3962
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771388964"
     variation       3966..3967
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:1323360002"
     variation       3985
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1435154012"
     variation       3989
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524912"
     variation       3990
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405501788"
     variation       3991
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1406940144"
     variation       3995
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908180050"
     variation       3996
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779115305"
     variation       3997
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:961053337"
     variation       4001
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:992707468"
     variation       4002
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:970975547"
     variation       4004
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1324047415"
     variation       4011
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:917180595"
     variation       4015
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150459354"
     variation       4017
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1044642876"
     variation       4020
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1377809037"
     variation       4028
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:936313731"
     variation       4030
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:926044398"
     variation       4033
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1558044479"
     variation       4036
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:910933976"
     variation       4044
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:936053669"
     variation       4045
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1349535088"
     variation       4054
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:577297529"
     variation       4063
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:942528678"
     variation       4066
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1358831238"
     variation       4068
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373441366"
     variation       4077
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040868431"
     variation       4080
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1053147625"
     variation       4082
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1558044513"
     variation       4086
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772476783"
     variation       4090
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1369683493"
     variation       4093
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1289731312"
     variation       4102
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:900987508"
     variation       4107
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1467549020"
     variation       4111
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1175634294"
     variation       4114
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1008860688"
     variation       4116
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1410334290"
     variation       4117
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1047420999"
     variation       4128
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472576764"
     variation       4133
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571525186"
     variation       4137
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1258633471"
     variation       4138
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:775911091"
     variation       4140
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190461384"
     variation       4142
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886476861"
     variation       4149
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867140698"
     variation       4152
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1253823028"
     variation       4156..4160
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1209057805"
     variation       4158
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:748572904"
     variation       4160
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:900801582"
     variation       4165
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187013832"
     variation       4167
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1285794028"
     variation       4173
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1028267063"
     variation       4174
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:562902720"
     variation       4178
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571525305"
     variation       4179
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:952260344"
     variation       4191
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1349744611"
     variation       4195
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1005690253"
     variation       4204
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1015357293"
     variation       4210
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558044613"
     variation       4211
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1302473591"
     variation       4213
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1454563987"
     variation       4214
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1016305334"
     variation       4234
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571525374"
     variation       4236
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760758168"
     variation       4242
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1157078579"
     variation       4243
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1180637517"
     variation       4244
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1456804409"
     variation       4246
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280312662"
     variation       4247
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1419122766"
     variation       4256
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230820553"
     variation       4260
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474421509"
     variation       4264
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1473620966"
     variation       4269
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163661344"
     variation       4279
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412855344"
     variation       4280
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:992529735"
     variation       4282
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:573881035"
     variation       4284
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459791537"
     variation       4285
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1180889501"
     variation       4290
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:749578736"
     variation       4294
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1558044690"
     variation       4299
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1243510825"
     variation       4318
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1012385065"
     variation       4323
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1327870372"
     variation       4324
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:895988545"
     variation       4325
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1273674904"
     variation       4333..4335
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1235124302"
     variation       4336
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1010372536"
     variation       4340
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:190818629"
     variation       4342
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571525610"
     variation       4343
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768709724"
     variation       4344
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371564314"
     variation       4349
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1287334640"
     variation       4358
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1446138942"
     variation       4365
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:574586184"
     variation       4374
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:528307386"
     variation       4376
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:935849951"
     variation       4389
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:988822105"
     variation       4390
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138455027"
     variation       4393..4399
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="agaga"
                     /replace="agagaga"
                     /db_xref="dbSNP:1171505815"
     variation       4396
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:922498500"
     variation       4398
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:181559889"
     variation       4403
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1464040746"
     variation       4404
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944706412"
     variation       4406
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:185832619"
     variation       4411
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:550210083"
     variation       4419
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040375710"
     variation       4422
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1041811075"
     variation       4429
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227800875"
     variation       4432
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571525795"
     variation       4436
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1309049055"
     variation       4440
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571525812"
     variation       4448
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1295656208"
     variation       4450
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:929792632"
     variation       4453
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333207698"
     variation       4457
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558044817"
     variation       4470
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1371778004"
     variation       4473
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1328061248"
     variation       4477
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1220986344"
     variation       4479
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1390596814"
     variation       4490
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259340016"
     variation       4501
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1046982573"
     variation       4506
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:375873881"
     variation       4513
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111698027"
     variation       4514
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571525917"
     variation       4516
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1443761305"
     variation       4517
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448544906"
     variation       4519
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1187881361"
     variation       4520
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256527282"
     variation       4521
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1395142285"
     variation       4522
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190159894"
     variation       4523
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566347092"
     variation       4527
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1571525987"
     variation       4533
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:534916356"
     variation       4534
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1266510726"
     variation       4540..4541
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="gtg"
                     /db_xref="dbSNP:1196365547"
     variation       4541
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113819464"
     variation       4542..4543
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1272255448"
     variation       4546
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1244316108"
     variation       4558
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1445860121"
     variation       4559
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1156308653"
     variation       4562
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379224421"
     variation       4563
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1037639972"
     variation       4564
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1160895854"
     variation       4565
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1364386901"
     variation       4568
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308323876"
     variation       4569
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368896544"
     variation       4573
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1393718305"
     variation       4576
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571526114"
     variation       4581
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1357177381"
     variation       4587
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751335822"
     variation       4589
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:895139826"
     variation       4592
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762735499"
     variation       4597
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571526162"
     variation       4598
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1012311410"
     variation       4599..4608
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="ctcccccggc"
                     /db_xref="dbSNP:1454588987"
     variation       4601..4618
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cccccggca"
                     /replace="cccccggcacccccggca"
                     /db_xref="dbSNP:1558044952"
     variation       4601..4605
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:764135164"
     variation       4601
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1307177222"
     variation       4604
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1215873715"
     variation       4605
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:557904479"
     variation       4606
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770561375"
     variation       4610..4614
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1286661447"
     variation       4610
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774067714"
     variation       4611
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209871817"
     variation       4614
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1264226356"
     variation       4615
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:906708754"
     variation       4617
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1177375922"
     variation       4622
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1237007607"
     variation       4623
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1000060382"
     variation       4624
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:571027024"
     variation       4627
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1470231391"
     variation       4627
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759134405"
     variation       4632
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1422653975"
     variation       4633
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1468394184"
     variation       4635
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1218784334"
     variation       4636
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:536700162"
     variation       4639
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1241781488"
     variation       4641
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867919323"
     variation       4644
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:557014623"
     variation       4645
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1408115043"
     variation       4646
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571526441"
     variation       4654
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767564399"
     variation       4655
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:573595757"
     variation       4663
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1353980339"
     variation       4665
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:976562971"
     variation       4666
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:922311476"
     variation       4668
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1158588887"
     variation       4670
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1365761665"
     variation       4676
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764598049"
     variation       4677
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:982998161"
     variation       4681
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:182360910"
     variation       4682..4686
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ag"
                     /replace="aggag"
                     /db_xref="dbSNP:1185653754"
     variation       4682
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1326156659"
     variation       4686
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1262726652"
     variation       4693
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1197266182"
     variation       4701
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1327175055"
     variation       4704
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:941312781"
     variation       4705
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1571526587"
     variation       4716
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1234505212"
     variation       4719
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1218548873"
     variation       4722
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1263761504"
     variation       4724
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:553017437"
     variation       4728
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571526621"
     variation       4729
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190994237"
     variation       4738
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1379430697"
     variation       4749
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1339468836"
     variation       4756
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1318571203"
     variation       4758
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143084650"
     variation       4763
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1173173856"
     variation       4768
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:948014112"
     variation       4770
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1319804904"
     variation       4787
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1373878724"
     variation       4788
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1046476739"
     variation       4806
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1421850501"
     variation       4809
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161194178"
     variation       4810..4815
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="at"
                     /replace="atagat"
                     /db_xref="dbSNP:1472363439"
     variation       4811
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1373797966"
     variation       4812
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:545237076"
     variation       4813
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1299156227"
     variation       4814
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:12137588"
     variation       4816
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116759584"
     variation       4817
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304141065"
     variation       4822
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1214851924"
     variation       4824
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1053061851"
     variation       4825
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571526773"
     variation       4835
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1228069760"
     variation       4837
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543983297"
     variation       4838
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1011200783"
     variation       4841
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230209711"
     variation       4842
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302178029"
     variation       4843
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:576984876"
     variation       4844
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1241922143"
     variation       4850..4853
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1558045400"
     variation       4850
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1441018820"
     variation       4851
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1286443035"
     variation       4852
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1485453705"
     variation       4855
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1203308358"
     variation       4861
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571526868"
     variation       4862
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1018529680"
     variation       4872
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:563796122"
     variation       4873
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:866848365"
     variation       4877
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1393455314"
     variation       4882
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194269226"
     variation       4885
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1197602716"
     variation       4886
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777413071"
     variation       4887
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377715625"
     variation       4892
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1441758417"
     variation       4902
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571526950"
     variation       4905
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:755364079"
     variation       4909
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1029432783"
     variation       4915
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1159544458"
     variation       4916
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571526972"
     variation       4919
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571526999"
     variation       4921
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1339560681"
     variation       4926
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1213289"
     variation       4927
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1234327436"
     variation       4933
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:982542625"
     variation       4940
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1295744057"
     variation       4941
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1558045489"
     variation       4942
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571527085"
     variation       4944
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016749580"
     variation       4952
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185807689"
     variation       4953
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146049929"
     variation       4954
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:915788244"
     variation       4956
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1324600459"
     variation       4957
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140017132"
     variation       4965
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41266622"
     variation       4969
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1423202291"
     variation       4978
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1309616314"
     variation       4982
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1180661042"
     variation       4983
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1254609474"
     variation       4985
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:551569750"
     variation       4989
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1316044169"
     variation       5004
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:927972228"
     variation       5009
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:571554122"
     variation       5010
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571527214"
     variation       5011
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746247722"
     variation       5021
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537238536"
     variation       5026
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:556812877"
     variation       5033
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357001564"
     variation       5035
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273399073"
     variation       5047
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1211212188"
     variation       5050
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772366889"
     variation       5052
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:935437826"
     variation       5054
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1052518806"
     variation       5063
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:894012230"
     variation       5064..5072
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tctctct"
                     /replace="tctctctct"
                     /db_xref="dbSNP:1351230935"
     variation       5071..5080
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ct"
                     /replace="ctttcctgct"
                     /db_xref="dbSNP:200522109"
     variation       5072..5074
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1290173667"
     variation       5072
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:946834907"
     variation       5078
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1039982415"
     variation       5079
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:567330020"
     variation       5081
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:900060161"
     variation       5086
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1450542031"
     variation       5087
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1357487611"
     variation       5095
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1175377847"
     variation       5096
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:576814142"
     variation       5108
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:542206938"
     variation       5112
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997875225"
     variation       5113
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192322594"
     variation       5141
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250098825"
     variation       5142
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1157614454"
     variation       5149
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1571527455"
     variation       5150..5157
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaaa"
                     /replace="aaaaaaaaa"
                     /db_xref="dbSNP:1417654637"
     variation       5157
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1258699485"
     variation       5171..5177
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /db_xref="dbSNP:1558045678"
     variation       5176
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780597576"
     variation       5178
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1483998359"
     variation       5179..5183
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="actca"
                     /db_xref="dbSNP:1235392861"
     variation       5182
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1369448550"
     variation       5185
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747512058"
     variation       5186
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866922454"
     variation       5193
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886761510"
     variation       5216
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1004411019"
     variation       5225
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1293741075"
     variation       5226
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768764647"
     variation       5227
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1431506039"
     variation       5237
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1298334512"
     variation       5238
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1319087628"
     variation       5247
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1419229968"
     variation       5252..5260
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tgatga"
                     /replace="tgatgatga"
                     /db_xref="dbSNP:1167269262"
     variation       5256
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372182793"
     variation       5267
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:183653789"
     variation       5273
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:991257001"
     variation       5285
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761907288"
     variation       5298
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571527638"
     variation       5299..5308
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaaaa"
                     /replace="aaaaaaaaaa"
                     /replace="aaaaaaaaaaa"
                     /db_xref="dbSNP:540998480"
     variation       5304
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571527657"
     variation       5305
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571527666"
     variation       5309
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1355917665"
     variation       5311..5316
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1558045772"
     variation       5316
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1232603706"
     variation       5317
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464341771"
     variation       5318
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265964788"
     variation       5319
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:981363270"
     variation       5330
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1319726161"
     variation       5331
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1320023910"
     variation       5334
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1367431878"
     variation       5340
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295425702"
     variation       5345..5349
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aa"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1199375870"
     variation       5347
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1395808691"
     variation       5354
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1250933959"
     variation       5367..5369
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="ata"
                     /db_xref="dbSNP:1479763227"
     variation       5370
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1183868164"
     variation       5373
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189051618"
     variation       5374
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:545278031"
     variation       5376
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:558889991"
     variation       5382..5383
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:927993386"
     variation       5384
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1186047223"
     variation       5400
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448380645"
     variation       5405
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1267909888"
     variation       5414..5415
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:935337355"
     variation       5416
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:4035254"
     variation       5417
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1487362870"
     variation       5418
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2347802"
     variation       5419
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759500246"
     variation       5421
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344509610"
     variation       5429
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466685611"
     variation       5432
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1417836849"
     variation       5439
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1272795753"
     variation       5441
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227702500"
     variation       5442..5445
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaca"
                     /replace="aacaaaca"
                     /db_xref="dbSNP:138419870"
     variation       5446
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:575553123"
     variation       5449
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4035255"
     variation       5451..5458
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ctac"
                     /replace="ctacctac"
                     /db_xref="dbSNP:1039867328"
     variation       5457
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:921429942"
     variation       5461
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1367331352"
     variation       5468
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1299042568"
     variation       5470
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1432021512"
     variation       5474
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1371976973"
     variation       5479
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2881731"
     variation       5483
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1166350685"
     variation       5484
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:15171"
     variation       5489
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1428509783"
     variation       5494
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1460143400"
     variation       5495
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1200904105"
     variation       5496
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1304300716"
     variation       5507
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1431421481"
     variation       5522
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:544408417"
     variation       5523
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1165469190"
     variation       5528
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1266598445"
     variation       5531
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1182586620"
     variation       5532
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355782680"
     variation       5543
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:934262098"
     variation       5544
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1204755699"
     variation       5546
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1051352075"
     variation       5547
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1257894431"
     variation       5554
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571528118"
     variation       5557
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1231178836"
     variation       5562
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886811300"
     variation       5572
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:964044349"
     variation       5576
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571528173"
     variation       5580
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1291307939"
     variation       5581
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1003801534"
     variation       5584
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:996499067"
     variation       5590
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1030219250"
     variation       5591
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1215129853"
     variation       5592
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1038102084"
     variation       5595
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1294917099"
     variation       5595
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:954731247"
     variation       5596
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1186341259"
     variation       5597..5613
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaaaaaa"
                     /replace="aaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaaa"
                     /db_xref="dbSNP:rs748191385"
     variation       5597
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1305896320"
     variation       5605
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1012605123"
     variation       5609
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571528321"
     variation       5610..5611
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1329869812"
     variation       5610
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1558046028"
     variation       5613
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1198762322"
     variation       5614..5615
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1212507244"
     variation       5614
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1269294741"
     variation       5615
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1327518242"
     variation       5621
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1023241917"
     variation       5625
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571528387"
     variation       5630
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485515509"
     variation       5640
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12119896"
     variation       5644
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1340665187"
     variation       5645
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1265921878"
     variation       5647
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1393771885"
     variation       5649
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1404776593"
     variation       5652..5666
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttatta"
                     /replace="ttattatgtttatta"
                     /db_xref="dbSNP:1003236225"
     variation       5655
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1031552058"
     variation       5668
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478414648"
     variation       5676
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:529361977"
     variation       5680
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1409682295"
     variation       5687
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186491042"
     variation       5688..5702
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttcttttctt"
                     /replace="ttcttttcttttctt"
                     /db_xref="dbSNP:1473021622"
     variation       5690
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1418164873"
     variation       5691
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1426225899"
     variation       5694
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1177718809"
     variation       5695
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:956923689"
     variation       5721
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1375706305"
     variation       5723
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463885644"
     variation       5724..5734
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaaaaa"
                     /replace="aaaaaaaaaaa"
                     /replace="aaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /db_xref="dbSNP:58819847"
     variation       5728
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:542673149"
     variation       5733..5734
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1285563035"
     variation       5734
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:988117627"
     variation       5735..5747
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tgttttgt"
                     /replace="tgttttgttttgt"
                     /db_xref="dbSNP:1297620788"
     variation       5735
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:915342672"
     variation       5735
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:968154812"
     variation       5747..5750
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="t"
                     /replace="tgtt"
                     /db_xref="dbSNP:1386311964"
     variation       5752
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1317585144"
     variation       5763
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149358308"
     variation       5766
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:528463714"
     variation       5769..5774
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ggggg"
                     /replace="gggggg"
                     /replace="ggggggg"
                     /db_xref="dbSNP:1392666462"
     variation       5774
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1161672620"
     variation       5776..5782
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttttttt"
                     /replace="tttttttt"
                     /db_xref="dbSNP:1424324783"
     variation       5779
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1391027881"
     variation       5781
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:921473870"
     variation       5782
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1447759001"
     variation       5787
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:551697787"
     variation       5788
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1247929205"
     variation       5791
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1359872563"
     variation       5792
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571528710"
     variation       5800
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182844405"
     variation       5801
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1288246318"
     variation       5805
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1051793499"
     variation       5807
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908768879"
     variation       5813
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867401720"
     variation       5818
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1274950182"
     variation       5819
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1229908013"
     variation       5821
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:939701372"
     variation       5825
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1038026995"
     variation       5826
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437188912"
     variation       5831
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1332589070"
     variation       5834
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:531037350"
     variation       5836
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:898146104"
     variation       5838
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1170772770"
     variation       5839
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1044144167"
     variation       5842
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:907036636"
     variation       5844
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215621908"
     variation       5846
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1479257397"
     variation       5850
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1245492111"
     variation       5853
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240883900"
     variation       5854
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1483598598"
     variation       5859
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:867822394"
     variation       5860
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1032025653"
     variation       5863
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1395201047"
     variation       5869
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1219313734"
     variation       5874
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:955913385"
     variation       5875
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1011486266"
     variation       5880..5886
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttct"
                     /replace="ttcttct"
                     /db_xref="dbSNP:1453402948"
     variation       5882
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1350928472"
     variation       5887
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:536352013"
     variation       5888
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1408300795"
     variation       5895
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1381933310"
     variation       5897
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354178781"
     variation       5898
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:968039793"
     variation       5916
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:975531093"
     variation       5919
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:533211472"
     variation       5920
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:955733613"
     variation       5925
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1473104608"
     variation       5933
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114960248"
     variation       5940
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:908689527"
     variation       5943
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1479418866"
     variation       5945
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438650250"
     variation       5946
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:940298152"
     variation       5957
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775632556"
     variation       5959
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1443693497"
     variation       5969
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1276383609"
     variation       5970
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760654643"
     variation       5978
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1329592158"
     variation       5992
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1311750053"
     variation       5995..5999
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1351780762"
     variation       6002
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372824101"
     variation       6007
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974291658"
     variation       6016
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1303668649"
     variation       6018
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1450268136"
     variation       6028
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357538564"
     variation       6030
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571529172"
     variation       6036
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1223606356"
     variation       6041
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458280886"
     variation       6049
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1391481930"
     variation       6063
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1157307086"
     variation       6068
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1418891239"
     variation       6076
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406722370"
     variation       6078
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:919626876"
     variation       6082
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473492291"
     variation       6085
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240794392"
     variation       6095
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1202502951"
     variation       6106
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1465240213"
     variation       6107
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554691625"
     variation       6116
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:144730408"
     variation       6131
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1316174727"
     variation       6133
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571529315"
     variation       6138
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1313668948"
     variation       6148
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:566522040"
     variation       6149
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467694374"
     variation       6157
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:538630882"
     variation       6159
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1191289222"
     variation       6160
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314399225"
     variation       6167
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:938527220"
     variation       6170
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1367917876"
     variation       6178..6179
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:558782324"
     variation       6179
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:558929685"
     variation       6181
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12723035"
     variation       6185
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1453463821"
     variation       6186
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187111912"
     variation       6187
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764812680"
     variation       6190
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1383009466"
     variation       6197
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1406992840"
     variation       6198
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1021547385"
     variation       6199
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571529478"
     variation       6200
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:554715941"
     variation       6203
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249793506"
     variation       6206
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750078828"
     variation       6208
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148544292"
     variation       6209
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376221491"
     variation       6210
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543062977"
     variation       6211
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229167713"
     variation       6218
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1367499994"
     variation       6225
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1336614867"
     variation       6231
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1382217074"
     variation       6232
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1483820672"
     variation       6234
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1295589808"
     variation       6237
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:758829305"
     variation       6245
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:559410549"
     variation       6246
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1278124731"
     variation       6256
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:372152597"
     variation       6259
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1234434786"
     variation       6263
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1273110322"
     variation       6266
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1333445151"
     variation       6270
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:961517255"
     variation       6274
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974303277"
     variation       6276
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1192665367"
     variation       6278
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1268416175"
     variation       6279
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1274625696"
     variation       6280
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1206185262"
     variation       6283
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344395609"
     variation       6291
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:780366336"
     variation       6306
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:948407905"
     variation       6307
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313258215"
     variation       6320
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191566129"
     variation       6326
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304081906"
     variation       6335
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:979763801"
     variation       6338
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377612148"
     variation       6344
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184546154"
     variation       6359
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302139796"
     variation       6364
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1410114498"
     variation       6367
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1230947481"
     variation       6375..6378
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ca"
                     /replace="caca"
                     /db_xref="dbSNP:1558046789"
     variation       6376
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781697970"
     variation       6381
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:548221987"
     variation       6384
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370785680"
     variation       6397
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:531072286"
     variation       6398
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1053278828"
     variation       6399
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769851721"
     variation       6418
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1188500615"
     variation       6420
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773361630"
     variation       6428
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1484122639"
     variation       6429
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111404742"
     variation       6430
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:947172153"
     variation       6433
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571529892"
     variation       6437
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042999528"
     variation       6438
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1258254026"
     variation       6442
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1222297521"
     variation       6449
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1558046848"
     variation       6452
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:900398155"
     variation       6456
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1289311183"
     variation       6459
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230624944"
     variation       6462
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1337120024"
     variation       6465
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868025826"
     variation       6469
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304438374"
     variation       6476
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1390286348"
     variation       6481
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172875520"
     variation       6486
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304506692"
     variation       6490..6496
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaa"
                     /replace="aaaaaaaa"
                     /db_xref="dbSNP:80017588"
     variation       6496
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:996481212"
     variation       6509
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780960576"
     variation       6510
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1409593590"
     variation       6514
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1327183791"
     variation       6522
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:891116106"
     variation       6526
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1424471559"
     variation       6537
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373883472"
     variation       6540
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558046935"
     variation       6543
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1558046937"
     variation       6550
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1258421433"
     variation       6551..6557
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aag"
                     /replace="aagcaag"
                     /db_xref="dbSNP:764394551"
     variation       6561
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461205653"
     variation       6564..6573
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaagaa"
                     /replace="aaagaaagaa"
                     /db_xref="dbSNP:1269355417"
     variation       6566
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1361197413"
     variation       6571
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749513422"
     variation       6576
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1349040979"
     variation       6589
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1015598005"
     variation       6599
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340714023"
     variation       6600
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1293159451"
     variation       6605
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354150536"
     variation       6606
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:974187069"
     variation       6611
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221045595"
     variation       6612
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1027205674"
     variation       6623
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1402202801"
     variation       6634
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1571530248"
     variation       6639
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772028969"
     variation       6641
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:970365954"
     variation       6644..6649
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aat"
                     /replace="aataat"
                     /db_xref="dbSNP:1370420984"
     variation       6648..6654
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="atga"
                     /replace="atgatga"
                     /db_xref="dbSNP:1270467167"
     variation       6650
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:561484585"
     variation       6652
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1249161644"
     variation       6673
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1191094438"
     variation       6675
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445630720"
     variation       6676
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189019083"
     variation       6686
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210816620"
     variation       6688
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1211375343"
     variation       6690
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356566690"
     variation       6696
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571530353"
     variation       6709..6712
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tt"
                     /replace="tttt"
                     /db_xref="dbSNP:1293525408"
     variation       6712
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256596907"
     variation       6714..6719
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tttttt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:200183940"
     variation       6714
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1298239463"
     variation       6715
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1558047071"
     variation       6724
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:928360764"
     variation       6726..6733
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttttttt"
                     /replace="tttttttt"
                     /replace="ttttttttt"
                     /db_xref="dbSNP:959968547"
     variation       6726
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1373715756"
     variation       6727
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1553254349"
     variation       6734
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1161955936"
     variation       6735..6738
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1475129109"
     variation       6737
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1424063150"
     variation       6738
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190243054"
     variation       6741..6749
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="taaa"
                     /replace="taaaataaa"
                     /db_xref="dbSNP:912947858"
     variation       6743..6753
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaataaa"
                     /replace="aaataaataaa"
                     /db_xref="dbSNP:1171016040"
     variation       6752
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:947222942"
     variation       6756
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1242080116"
     variation       6761
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199967377"
     variation       6764
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1371782272"
     variation       6775
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1453737466"
     variation       6779
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900741905"
     variation       6785..6790
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tt"
                     /replace="ttactt"
                     /db_xref="dbSNP:749999220"
     variation       6785
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:932197377"
     variation       6788
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571530561"
     variation       6795
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1312619878"
     variation       6799
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142594726"
     variation       6800
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:887906952"
     variation       6801
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1402378278"
     variation       6811..6813
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1337318368"
     variation       6818
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:891135147"
     variation       6829
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1326432970"
     variation       6832
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1347206836"
     variation       6841
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755609686"
     variation       6843
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:562841172"
     variation       6847
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1371413015"
     variation       6848
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571530699"
     variation       6851..6902
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ct"
                     /replace="ctacccctccccttttcttattattcagaatataaacctgcaaagctc
                     tgct"
                     /db_xref="dbSNP:1268007133"
     variation       6858
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1349565909"
     variation       6862
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896947437"
     variation       6863
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1013914189"
     variation       6870
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1279326667"
     variation       6873
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995537779"
     variation       6875
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027134098"
     variation       6885
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199165933"
     variation       6890
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1479866182"
     variation       6895
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484607121"
     variation       6900
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1023946354"
     variation       6920
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1435617372"
     variation       6921
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1272166128"
     variation       6932
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262362525"
     variation       6939
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1446450747"
     variation       6942
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:566559122"
     variation       6945
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1281074952"
     variation       6949
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1222707164"
     variation       6949
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:980384881"
     variation       6957
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1255004486"
     variation       6970
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1440074396"
     variation       6974
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354082485"
     variation       6980
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959739222"
     variation       6985
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1471211373"
     variation       6987
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1032936450"
     variation       6993..6996
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="taat"
                     /db_xref="dbSNP:1404545952"
     variation       6996
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1454855514"
     variation       7004
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764156201"
     variation       7007
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:533769216"
     variation       7008
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761288537"
     variation       7009
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:913299221"
     variation       7018
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393650182"
     variation       7019
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968478422"
     variation       7035
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944822679"
     variation       7037
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1231869805"
     variation       7044
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:978503188"
     variation       7047
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1462544200"
     variation       7061
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1261204902"
     variation       7062
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:976151749"
     variation       7065
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538668935"
     variation       7069
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571531065"
     variation       7076
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192705206"
     variation       7078..7086
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaa"
                     /replace="aaaaaaaa"
                     /replace="aaaaaaaaa"
                     /replace="aaaaaaaaaa"
                     /db_xref="dbSNP:921821272"
     variation       7087
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:754047615"
ORIGIN      
aaacaaaagcaggaggctgacggggctgctggagtttgcagagacacggaggaggagagagcctgtgctttgcctgccgccgcggctgggggagatctggcttttgcaacagcccaccccctttgagatcactctggcccggagtgggggtggggggcagcggggggtggggggggaaagtttgcattgcaatccccctgccttcctctcctttctcccgatcaatgcatatttgcaaaaggattaagccacagatttaagcgccgggagcccatttctgccttgcaaaggagaccggactgaaaaacctaaagccagctctgatttcttttcgccaagtgggaaggtggtttatttttcttgctttttggagtcaacacccttccccaccagcccttatccccaccctcaccccgcaaccccttcacgccccctccccctccccctcctcatcctcccaccatcctctaaagaggcaaagggattttttttttcttttggtcttcttttttcccccttccctgtttatcctgaaaaggatttgaagacaagcttgaaggataaaaagccttggtgcttcccaggagccgagccgaggagcagaagaggaagagccgggggctgccgtagcctttggagatggacgagcagcccaggctgatgcattcccatgctggggtcgggatggccggacaccccggcctgtcccagcacttgcaggatggggccggagggaccgagggggagggcgggaggaagcaggacattggagacattttacagcaaattatgaccatcacagaccagagtttggatgaggcgcaggccagaaaacatgctttaaactgccacagaatgaagcctgccttgtttaatgtgttgtgtgaaatcaaagaaaaaacagttttgagtatccgaggagcccaggaggaggaacccacagacccccagctgatgcggctggacaacatgctgttagcggaaggcgtggcggggcctgagaagggcggagggtcggcggcagcggcggcagcggcggcggcttctggaggggcaggttcagacaactcagtggagcattcagattacagagccaaactctcacagatcagacaaatctaccatacggagctggagaaatacgagcaggcctgcaacgagttcaccacccacgtgatgaatctcctgcgagagcaaagccggaccaggcccatctccccaaaggagattgagcggatggtcagcatcatccaccgcaagttcagctccatccagatgcagctcaagcagagcacgtgcgaggcggtgatgatcctgcgttcccgatttctggatgcgcggcggaagagacggaatttcaacaagcaagcgacagaaatcctgaatgaatatttctattcccatctcagcaacccttaccccagtgaggaagccaaagaggagttagccaagaagtgtggcatcacagtctcccaggtatcaaactggtttggaaataagcgaatccggtacaagaagaacataggtaaatttcaagaggaagccaatatttatgctgccaaaacagctgtcactgctaccaatgtgtcagcccatggaagccaagctaactcgccctcaactcccaactcggctggttcttccagttcttttaacatgtcaaactctggagatttgttcatgagcgtgcagtcactcaatggggattcttaccaaggggcccaggttggagccaacgtgcaatcacaggtggatacccttcgccatgttatcagccagacaggaggatacagtgatggactcgcagccagtcagatgtacagtccgcagggcatcagtgctaatggaggttggcaggatgctactaccccttcatcagtgacctcccctacagaaggccctggcagtgttcactctgatacctccaactgatctcccagcaatcgcatcccggctgaccctgtgccccagttggggcaggggcaggagggagggtttctctcccaacgctgaagcggtcagactggaggtcgaagcaatcagcaaacacaataagagtctccttctcttctcttctttgggatgctatttcagccaatctggacacttctttatactctcttcccttttttttctgggtagaagccacccttccctgcctccagctgtcagcctggttttcgtcatcttccctgcccctgtgcctctgtcctagactcccggggtccccgccctctctcatatcactgaaggatattttcaacaattagaggaatttaaagaggaaaaaaattacaaagaaaataataaaagtgtttgtacgttttcatgctggtggtttgaggagccaaatttacctcactcgaatccctcactccctatgttaacaggcaatccttctctgtttctcttattactctcactacctcttagcaggaatactccacattgccctattcattccaggcctccctgcttcctcttgctcttcctccctggggacagtactgattggaacactttcctcctcttccttcctagccccagctattcactggggactgtcatagctgggattctaaaggtgccacatttttcagtttcatctccactaggttggttcccgggcaggaagtcaggcagcagggaaggacacgggaacagcaggtggagaattcctacagtctttcttaccctgctagcaatagctctcagtttcagaggcacagtctttggagaccattcagcactgagaaagcaatatttagaacctattgcaaaactgggcctgagttaggcatggtgatgaatgcatcagcaaggaatagaaagttcttatcgtgaaacccttcaacctcaactatgccttcatagacacacacgttcatgcacatgtaggcacatgtaccatctcacatcttcactttcccgagatgccatatacaattacctacattaataactgtagcactatgccttttgagcccgagagagggaattagtgactctaagtgaaggtcactgacacagagaagcagtatgtgtctggggcttccaggacctgcaggcccactagcgtgcacttaccagaatggcatacacaggacctgatcatgaggaagaccaggtttccagtgtaaactactcttgttcccaccacctctggagcactcagggagccccatacagtacttacaatgtctttaatggacttgattctgtttaattttttgttttatattaggcacactgtattaattttccaaaatgttataccacactatgttcttggtcctgacctattgctctggaggaaagagttgtataagaacgtggctcatgtgaacttttgctagcttcatttgaggacctgagaatcatggggaaagggaaggtaatgttttcattgaaatcatcacagtgatttttattccctgggaacacagcgtgtactaaaaatacatgagaaaatagcatgtatatgaaagctattctcaaaagtcacctgagctcaccatcttcatagccaaccctaccagttataaagatggcagctctatcacttgattaagtgggaggtggtcaaatattttggtgcctcattttcttcatctgtgagatgggaactgttatgcctggcttactaagagtcttgtgagagactgagaagttgattttgttcatatccaatctgtaaatgcgaagtcaggggaagtaatgtccctgaaataaacgggttcatgccatctagggacaataaatggttttcttgttgtaacttctggttaatatcagtaccttgatgtcatcaccgtgatgacaaagagaagagttattgttgatcttcttggttttggtctgtctcttttcttaggataaagaaaaacttccaaactagaaaaacaggccctggttcccttagtttgcacttgaacccaatatgttgccttgtacatacttggtccctgtcacattgactgcttgggaggcttccagggagaagtatgagaccctgaggggtgagaatgggcagctagcaagaacatggaaattctgcttggcactacagtcataaatagaaaacactgtgtgtgctcaggggagcaggggatgccactgaagaaactcaagggaatgtgtatttgaaggaaatgcaaaaactaagtatttagcaaaatgaaattatgccttgatgactaaaaggcactagaaaggttgtgtctactaacttcagccctaatcagaacagatgcctagaaggagcatttttgtgacaacttcatagtgattagaatcagtggagaactccatcttagtggcaggaatataatgaaactacccacgcaagaacatggttgaatcacatttgcttgacttagggcaaagtacgaaagagagacaaaagggttctcttggaaacaagaagagtgactccagatgtggcctgaataattgccatgttaagttaatgcaaaagatcagaacagggctacatttgcacaggcagtttctctccgggccgtagttttcactgatgatcacctttcacagcattttccccaaccagcatttcacttagtcttctctatacccagcacctcccccggcacccccggcaagcccactatcacttccgacttccaacgtggcatccgtgagatctgtccacattaggcgaagcaggagaacactgagagcagcaggatgggtttggaaagagcatgcctctggaaacacagcttcctgggaattcacatgaggccagtcctacagagagcaagatgcaccccaggatttcttcattttctaatagatgtgggagtgctccattttccccgacagcgaatttcccctgagaaacgatactagaccctgggtttgcccaccttgtaactcttccttatctcctccttttcatccctaatccatcctccctctggcatggaattgacgcccgtgcagtacatttgccaagtggcaccttctttcaatttatgttttattttgctatggtggtgattctttatttgctggttgtcttttctcacacatctttctctctgtctctctctttcctgctctttgtttttctgcccagaaaaacctgacttcgataccaaaaaagatgaaactacagaaactcaaatttaaaaaaaactttaaaagaaacaaaaaaatactcaacgattctttcagctttattaacattttccattgtttcttgcgacttgtgtctcgttctttgtagtattgatgatgaacatttgataatgaatgttcttgtatattcagataaagaaaaaaaaaaccaaaaaagcggtctgaatttaatagtgtttataataaaaattttaaaaatgaccctcatagcacgcaaaacaggatggggaatttcccctcttctttctgtgacaatgcgcatcattcctgcattagtttttaacaccagactacctacattcatcatttccctcatttttcttttattttcttgcatttgtgaattagttcaagaatgctagaaaagtgtcgagttgtgcacatccatttcttgtttcacaatgtttaaaagtgacagtaattcattttgtaaactaaaaaaaaaaaaaaaaaggttggaatagtgagcataataggtacaacctaacacattattatgtttattaactttgagacccagaaataaattcttttcttttcttgattcttgctcttaaaaatacaaaaaaaaaaatgttttgttttgtgttatttttggtttgtttattggggggctttttttaattgtcaggattatgatcttgctgtttttcttcaatatgtatacaaggtgatgtgaaaagatgacttgggcagaggagtaagaacaagtaggcttgttcttctactttgcttcagaattcagttaatgccaaaagcgaagatcaagcccatgttgatgtctcgttgctcacctgcatttccagagagtgtgacactcatgcagtccctgagaaaaataaaatcagggacatacttctccttttagccttttaaaaattcaaaaacgtttagtccaagggaactttttatgctatcaggaaaggtttttgctgtttttgattctgattatcacagccaagtactttgttttatttctccctaattaataactacattccatgaggcctcttccaaccaaagaggccttttcttccaggagagtcccgcaggagatgctggtatgatgggcaccattggttaagtaaactacatgcaggaagaagtccttggggccagtctgccagctgagtcctggttttggatgaagagttaatgagatattgggccaggctcaatgctgtagttttaatgctaagaggttacgtttacttcacagagtacacctcttagtaacctctgacttaggcagctgcttaaagcaaattgcaaaactggcttgatttggaatgtttttattagaggaaaaaagaaagccatattatctggaaaaaaattcattttaaataccatcattcaacaaattatgttcagaaagtggtcagaacttaagcaagaaaagtaaagaaagaatgcagaattgtggagcaatgctttaggaaatatttctacctgaacacttgtactcttgaagtcacaacaaaataatgatgagcttttcacatcacctttatggtttcaatccctagctcaaagcttcctggaatcttttattttttgtaaacttttttttcttttgttaaaataaataaaacattcaatgtttttctccttttctctcttattacttctttcctttggcattttcaatttgaaatgctttcctttggttgttggttttattctccccctacccctccccttttcttattattcagaatataaacctgcaaagctctgctctgttttggttttgaaagtttaagcttttctgcttctgtgagagcacaggcttctgtcccttttgattccaactgaacttttgtgttctctaatgatactaacacggtgtaggttttacagtctcctaatttgtactggtaatgcatattccaaataaatagtttcttttgttgcaaaaaaaaat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]