2025-07-04 12:59:46, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001400469 867 bp mRNA linear PLN 23-FEB-2022 DEFINITION Glycine max uncharacterized LOC100306572 (LOC100306572), transcript variant 3, mRNA. ACCESSION NM_001400469 VERSION NM_001400469.1 KEYWORDS RefSeq. SOURCE Glycine max (soybean) ORGANISM Glycine max Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Phaseoleae; Glycine; Glycine subgen. Soja. REFERENCE 1 (bases 1 to 867) AUTHORS Sha AH, Li C, Yan XH, Shan ZH, Zhou XA, Jiang ML, Mao H, Chen B, Wan X and Wei WH. TITLE Large-scale sequencing of normalized full-length cDNA library of soybean seed at different developmental stages and analysis of the gene expression profiles based on ESTs JOURNAL Mol Biol Rep 39 (3), 2867-2874 (2012) PUBMED 21667246 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from HO038767.1, FK644821.1, ACUP04005895.1 and FG997135.1. Transcript Variant: This variant (3) has the short second exon and the long fourth exon. It encodes the short protein. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. ##Evidence-Data-START## RNAseq introns :: mixed/partial sample support SAMN09064557, SAMN09064558 [ECO:0000350] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-47 HO038767.1 5-51 48-250 FK644821.1 32-234 c 251-441 HO038767.1 274-464 442-466 ACUP04005895.1 29757-29781 c 467-566 HO038767.1 465-564 567-867 FG997135.1 14-314 c FEATURES Location/Qualifiers source 1..867 /organism="Glycine max" /mol_type="mRNA" /db_xref="taxon:3847" /chromosome="17" /map="17" gene 1..867 /gene="LOC100306572" /note="uncharacterized LOC100306572" /db_xref="GeneID:100306572" exon 1..91 /gene="LOC100306572" /inference="alignment:Splign:2.1.0" misc_feature 26..28 /gene="LOC100306572" /note="upstream in-frame stop codon" exon 92..225 /gene="LOC100306572" /inference="alignment:Splign:2.1.0" CDS 110..460 /gene="LOC100306572" /note="isoform 2 is encoded by transcript variant 3" /codon_start=1 /product="uncharacterized protein LOC100306572 isoform 2" /protein_id="NP_001387398.1" /db_xref="GeneID:100306572" /translation="
MAGPFELGSSKKKPGDGVNDLLTFNAENMQSNMKIIYYSRTFLSIIGGVVAGILGFTSLKGFVFYFLLMMVTSLGLVAKARFSIHSYFDSSNRVLLDGFLGGLMSFVLFWTYPSLL"
misc_feature 212..442 /gene="LOC100306572" /note="Region: EMC6; pfam07019" /db_xref="CDD:462067" exon 226..421 /gene="LOC100306572" /inference="alignment:Splign:2.1.0" exon 422..466 /gene="LOC100306572" /inference="alignment:Splign:2.1.0" exon 467..867 /gene="LOC100306572" /inference="alignment:Splign:2.1.0" ORIGIN
attggcatgaacgataacactgaactagctctcacgtttgtgcttgcacttgcacctctccaacgataacaacgacgagcacaagatccagacaaggcaggcacatagtatggctggaccttttgagttgggttcatcaaagaagaaaccaggggatggagtgaatgatttactcacttttaatgctgaaaatatgcaaagcaacatgaaaattatttattacagccgaacatttttgtctataattggtggagttgttgctggaattttggggttcacaagcttgaaaggatttgtattttacttccttctcatgatggttacttcacttgggcttgtagccaaagccagattttcaatccactcctactttgactcctcgaatcgagttctacttgatggcttcctaggtggtctaatgtcattcgtgctgttctggacgtatccttctcttttataatacttgatttgcattcgacattgtacatatattttgacggaggatcgtgcacaaaatgtctctaaagaaggcaattgttggcttctgacttctgttgctgctttaagaaggcaattgttctttatcttgattcttgacataatgcatgtacttcatcaagttattggatagctctcattatgttgccagtttttaaactttgtaagctctacttgctaatgctataagaccggtcctgaaattttatggaccaaactgaagcaattatattacttagttctaaattttacggtcacaatgtttccagtttttttttttaccaaaaaaaatagtttgtttcatctgaattctgtcaaaaaaataatgtataatctgaataatggaatgtgaaagtaatgtcatctctc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]