GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-31 21:50:37, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001400469             867 bp    mRNA    linear   PLN 23-FEB-2022
DEFINITION  Glycine max uncharacterized LOC100306572 (LOC100306572), transcript
            variant 3, mRNA.
ACCESSION   NM_001400469
VERSION     NM_001400469.1
KEYWORDS    RefSeq.
SOURCE      Glycine max (soybean)
  ORGANISM  Glycine max
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; indigoferoid/millettioid clade;
            Phaseoleae; Glycine; Glycine subgen. Soja.
REFERENCE   1  (bases 1 to 867)
  AUTHORS   Sha AH, Li C, Yan XH, Shan ZH, Zhou XA, Jiang ML, Mao H, Chen B,
            Wan X and Wei WH.
  TITLE     Large-scale sequencing of normalized full-length cDNA library of
            soybean seed at different developmental stages and analysis of the
            gene expression profiles based on ESTs
  JOURNAL   Mol Biol Rep 39 (3), 2867-2874 (2012)
   PUBMED   21667246
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            HO038767.1, FK644821.1, ACUP04005895.1 and FG997135.1.
            
            Transcript Variant: This variant (3) has the short second exon and
            the long fourth exon. It encodes the short protein.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            RNAseq introns :: mixed/partial sample support SAMN09064557,
                              SAMN09064558 [ECO:0000350]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-47                HO038767.1         5-51
            48-250              FK644821.1         32-234              c
            251-441             HO038767.1         274-464
            442-466             ACUP04005895.1     29757-29781         c
            467-566             HO038767.1         465-564
            567-867             FG997135.1         14-314              c
FEATURES             Location/Qualifiers
     source          1..867
                     /organism="Glycine max"
                     /mol_type="mRNA"
                     /db_xref="taxon:3847"
                     /chromosome="17"
                     /map="17"
     gene            1..867
                     /gene="LOC100306572"
                     /note="uncharacterized LOC100306572"
                     /db_xref="GeneID:100306572"
     exon            1..91
                     /gene="LOC100306572"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    26..28
                     /gene="LOC100306572"
                     /note="upstream in-frame stop codon"
     exon            92..225
                     /gene="LOC100306572"
                     /inference="alignment:Splign:2.1.0"
     CDS             110..460
                     /gene="LOC100306572"
                     /note="isoform 2 is encoded by transcript variant 3"
                     /codon_start=1
                     /product="uncharacterized protein LOC100306572 isoform 2"
                     /protein_id="NP_001387398.1"
                     /db_xref="GeneID:100306572"
                     /translation="
MAGPFELGSSKKKPGDGVNDLLTFNAENMQSNMKIIYYSRTFLSIIGGVVAGILGFTSLKGFVFYFLLMMVTSLGLVAKARFSIHSYFDSSNRVLLDGFLGGLMSFVLFWTYPSLL"
     misc_feature    212..442
                     /gene="LOC100306572"
                     /note="Region: EMC6; pfam07019"
                     /db_xref="CDD:462067"
     exon            226..421
                     /gene="LOC100306572"
                     /inference="alignment:Splign:2.1.0"
     exon            422..466
                     /gene="LOC100306572"
                     /inference="alignment:Splign:2.1.0"
     exon            467..867
                     /gene="LOC100306572"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
attggcatgaacgataacactgaactagctctcacgtttgtgcttgcacttgcacctctccaacgataacaacgacgagcacaagatccagacaaggcaggcacatagtatggctggaccttttgagttgggttcatcaaagaagaaaccaggggatggagtgaatgatttactcacttttaatgctgaaaatatgcaaagcaacatgaaaattatttattacagccgaacatttttgtctataattggtggagttgttgctggaattttggggttcacaagcttgaaaggatttgtattttacttccttctcatgatggttacttcacttgggcttgtagccaaagccagattttcaatccactcctactttgactcctcgaatcgagttctacttgatggcttcctaggtggtctaatgtcattcgtgctgttctggacgtatccttctcttttataatacttgatttgcattcgacattgtacatatattttgacggaggatcgtgcacaaaatgtctctaaagaaggcaattgttggcttctgacttctgttgctgctttaagaaggcaattgttctttatcttgattcttgacataatgcatgtacttcatcaagttattggatagctctcattatgttgccagtttttaaactttgtaagctctacttgctaatgctataagaccggtcctgaaattttatggaccaaactgaagcaattatattacttagttctaaattttacggtcacaatgtttccagtttttttttttaccaaaaaaaatagtttgtttcatctgaattctgtcaaaaaaataatgtataatctgaataatggaatgtgaaagtaatgtcatctctc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]