2024-05-20 09:43:20, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001400468 842 bp mRNA linear PLN 23-FEB-2022 DEFINITION Glycine max uncharacterized LOC100306572 (LOC100306572), transcript variant 2, mRNA. ACCESSION NM_001400468 XM_006600065 VERSION NM_001400468.1 KEYWORDS RefSeq. SOURCE Glycine max (soybean) ORGANISM Glycine max Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Phaseoleae; Glycine; Glycine subgen. Soja. REFERENCE 1 (bases 1 to 842) AUTHORS Sha AH, Li C, Yan XH, Shan ZH, Zhou XA, Jiang ML, Mao H, Chen B, Wan X and Wei WH. TITLE Large-scale sequencing of normalized full-length cDNA library of soybean seed at different developmental stages and analysis of the gene expression profiles based on ESTs JOURNAL Mol Biol Rep 39 (3), 2867-2874 (2012) PUBMED 21667246 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from HO038767.1, FK644821.1 and FG997135.1. On Jan 25, 2022 this sequence version replaced XM_006600065.4. Transcript Variant: This variant (2) has the short second exon and the short fourth exon. It encodes the long protein. ##Evidence-Data-START## Transcript exon combination :: SRR12327382.4279569.1, SRR12327364.707598.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN09064559, SAMN12210912 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-47 HO038767.1 5-51 48-250 FK644821.1 32-234 c 251-541 HO038767.1 274-564 542-842 FG997135.1 14-314 c FEATURES Location/Qualifiers source 1..842 /organism="Glycine max" /mol_type="mRNA" /db_xref="taxon:3847" /chromosome="17" /map="17" gene 1..842 /gene="LOC100306572" /note="uncharacterized LOC100306572" /db_xref="GeneID:100306572" exon 1..91 /gene="LOC100306572" /inference="alignment:Splign:2.1.0" misc_feature 26..28 /gene="LOC100306572" /note="upstream in-frame stop codon" exon 92..225 /gene="LOC100306572" /inference="alignment:Splign:2.1.0" CDS 110..472 /gene="LOC100306572" /note="isoform 1 is encoded by transcript variant 2" /codon_start=1 /product="uncharacterized protein LOC100306572 isoform 1" /protein_id="NP_001387397.1" /db_xref="GeneID:100306572" /translation="
MAGPFELGSSKKKPGDGVNDLLTFNAENMQSNMKIIYYSRTFLSIIGGVVAGILGFTSLKGFVFYFLLMMVTSLGLVAKARFSIHSYFDSSNRVLLDGFLGGLMSFVLFWTFAFDIVHIF"
misc_feature 212..442 /gene="LOC100306572" /note="Rab5-interacting protein (Rab5ip); Region: Rab5ip; pfam07019" /db_xref="CDD:429250" exon 226..421 /gene="LOC100306572" /inference="alignment:Splign:2.1.0" exon 422..441 /gene="LOC100306572" /inference="alignment:Splign:2.1.0" exon 442..842 /gene="LOC100306572" /inference="alignment:Splign:2.1.0" ORIGIN
attggcatgaacgataacactgaactagctctcacgtttgtgcttgcacttgcacctctccaacgataacaacgacgagcacaagatccagacaaggcaggcacatagtatggctggaccttttgagttgggttcatcaaagaagaaaccaggggatggagtgaatgatttactcacttttaatgctgaaaatatgcaaagcaacatgaaaattatttattacagccgaacatttttgtctataattggtggagttgttgctggaattttggggttcacaagcttgaaaggatttgtattttacttccttctcatgatggttacttcacttgggcttgtagccaaagccagattttcaatccactcctactttgactcctcgaatcgagttctacttgatggcttcctaggtggtctaatgtcattcgtgctgttctggacatttgcattcgacattgtacatatattttgacggaggatcgtgcacaaaatgtctctaaagaaggcaattgttggcttctgacttctgttgctgctttaagaaggcaattgttctttatcttgattcttgacataatgcatgtacttcatcaagttattggatagctctcattatgttgccagtttttaaactttgtaagctctacttgctaatgctataagaccggtcctgaaattttatggaccaaactgaagcaattatattacttagttctaaattttacggtcacaatgtttccagtttttttttttaccaaaaaaaatagtttgtttcatctgaattctgtcaaaaaaataatgtataatctgaataatggaatgtgaaagtaatgtcatctctc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]