LOCUS       NM_001399252            1620 bp    mRNA    linear   ROD 31-MAR-2024
DEFINITION  Rattus norvegicus angiopoietin-like 3 (Angptl3), transcript variant
            1, mRNA.
ACCESSION   NM_001399252 XM_006238440
VERSION     NM_001399252.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1620)
  AUTHORS   Zhao,Y., Goto,M., Vaziri,N.D., Khazaeli,M., Liu,H., Farahanchi,N.,
            Khanifar,E., Farzaneh,T., Haslett,P.A., Moradi,H. and
            Soundarapandian,M.M.
  TITLE     RNA Interference Targeting Liver Angiopoietin-Like Protein 3
            Protects from Nephrotic Syndrome in a Rat Model Via Amelioration of
            Pathologic Hypertriglyceridemia
  JOURNAL   J Pharmacol Exp Ther 376 (3), 428-435 (2021)
   PUBMED   33443084
  REMARK    GeneRIF: RNA Interference Targeting Liver Angiopoietin-Like Protein
            3 Protects from Nephrotic Syndrome in a Rat Model Via Amelioration
            of Pathologic Hypertriglyceridemia.
REFERENCE   2  (bases 1 to 1620)
  AUTHORS   Essalmani,R., Susan-Resiga,D., Chamberland,A., Asselin,M.C.,
            Canuel,M., Constam,D., Creemers,J.W., Day,R., Gauthier,D., Prat,A.
            and Seidah,N.G.
  TITLE     Furin is the primary in vivo convertase of angiopoietin-like 3 and
            endothelial lipase in hepatocytes
  JOURNAL   J Biol Chem 288 (37), 26410-26418 (2013)
   PUBMED   23918928
REFERENCE   3  (bases 1 to 1620)
  AUTHORS   Quagliarini,F., Wang,Y., Kozlitina,J., Grishin,N.V., Hyde,R.,
            Boerwinkle,E., Valenzuela,D.M., Murphy,A.J., Cohen,J.C. and
            Hobbs,H.H.
  TITLE     Atypical angiopoietin-like protein that regulates ANGPTL3
  JOURNAL   Proc Natl Acad Sci U S A 109 (48), 19751-19756 (2012)
   PUBMED   23150577
REFERENCE   4  (bases 1 to 1620)
  AUTHORS   Sonnenburg,W.K., Yu,D., Lee,E.C., Xiong,W., Gololobov,G., Key,B.,
            Gay,J., Wilganowski,N., Hu,Y., Zhao,S., Schneider,M., Ding,Z.M.,
            Zambrowicz,B.P., Landes,G., Powell,D.R. and Desai,U.
  TITLE     GPIHBP1 stabilizes lipoprotein lipase and prevents its inhibition
            by angiopoietin-like 3 and angiopoietin-like 4
  JOURNAL   J Lipid Res 50 (12), 2421-2429 (2009)
   PUBMED   19542565
REFERENCE   5  (bases 1 to 1620)
  AUTHORS   Shimamura,M., Matsuda,M., Yasumo,H., Okazaki,M., Fujimoto,K.,
            Kono,K., Shimizugawa,T., Ando,Y., Koishi,R., Kohama,T., Sakai,N.,
            Kotani,K., Komuro,R., Ishida,T., Hirata,K., Yamashita,S.,
            Furukawa,H. and Shimomura,I.
  TITLE     Angiopoietin-like protein3 regulates plasma HDL cholesterol through
            suppression of endothelial lipase
  JOURNAL   Arterioscler Thromb Vasc Biol 27 (2), 366-372 (2007)
   PUBMED   17110602
REFERENCE   6  (bases 1 to 1620)
  AUTHORS   Inaba,T., Matsuda,M., Shimamura,M., Takei,N., Terasaka,N., Ando,Y.,
            Yasumo,H., Koishi,R., Makishima,M. and Shimomura,I.
  TITLE     Angiopoietin-like protein 3 mediates hypertriglyceridemia induced
            by the liver X receptor
  JOURNAL   J Biol Chem 278 (24), 21344-21351 (2003)
   PUBMED   12672813
REFERENCE   7  (bases 1 to 1620)
  AUTHORS   Ando,Y., Shimizugawa,T., Takeshita,S., Ono,M., Shimamura,M.,
            Koishi,R. and Furukawa,H.
  TITLE     A decreased expression of angiopoietin-like 3 is protective against
            atherosclerosis in apoE-deficient mice
  JOURNAL   J Lipid Res 44 (6), 1216-1223 (2003)
   PUBMED   12671033
REFERENCE   8  (bases 1 to 1620)
  AUTHORS   Shimamura,M., Matsuda,M., Kobayashi,S., Ando,Y., Ono,M., Koishi,R.,
            Furukawa,H., Makishima,M. and Shimomura,I.
  TITLE     Angiopoietin-like protein 3, a hepatic secretory factor, activates
            lipolysis in adipocytes
  JOURNAL   Biochem Biophys Res Commun 301 (2), 604-609 (2003)
   PUBMED   12565906
REFERENCE   9  (bases 1 to 1620)
  AUTHORS   Shimizugawa,T., Ono,M., Shimamura,M., Yoshida,K., Ando,Y.,
            Koishi,R., Ueda,K., Inaba,T., Minekura,H., Kohama,T. and
            Furukawa,H.
  TITLE     ANGPTL3 decreases very low density lipoprotein triglyceride
            clearance by inhibition of lipoprotein lipase
  JOURNAL   J Biol Chem 277 (37), 33742-33748 (2002)
   PUBMED   12097324
REFERENCE   10 (bases 1 to 1620)
  AUTHORS   Camenisch,G., Pisabarro,M.T., Sherman,D., Kowalski,J., Nagel,M.,
            Hass,P., Xie,M.H., Gurney,A., Bodary,S., Liang,X.H., Clark,K.,
            Beresini,M., Ferrara,N. and Gerber,H.P.
  TITLE     ANGPTL3 stimulates endothelial cell adhesion and migration via
            integrin alpha vbeta 3 and induces blood vessel formation in vivo
  JOURNAL   J Biol Chem 277 (19), 17281-17290 (2002)
   PUBMED   11877390
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000005.1.
            
            On Jan 5, 2022 this sequence version replaced XM_006238440.4.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FQ210243.1, SRR26643286.17051.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760400, SAMEA5760476
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-550               JAXUCZ010000005.1  118818494-118819043
            551-661             JAXUCZ010000005.1  118819598-118819708
            662-776             JAXUCZ010000005.1  118820808-118820922
            777-890             JAXUCZ010000005.1  118821943-118822056
            891-986             JAXUCZ010000005.1  118822310-118822405
            987-1253            JAXUCZ010000005.1  118824571-118824837
            1254-1620           JAXUCZ010000005.1  118825165-118825531
FEATURES             Location/Qualifiers
     source          1..1620
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="5"
                     /map="5q33"
     gene            1..1620
                     /gene="Angptl3"
                     /note="angiopoietin-like 3"
                     /db_xref="GeneID:502970"
                     /db_xref="RGD:1564505"
     exon            1..550
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    38..40
                     /gene="Angptl3"
                     /note="upstream in-frame stop codon"
     CDS             56..1423
                     /gene="Angptl3"
                     /note="isoform 1 precursor is encoded by transcript
                     variant 1; angiopoietin-related protein 3"
                     /codon_start=1
                     /product="angiopoietin-related protein 3 isoform 1
                     precursor"
                     /protein_id="NP_001386181.1"
                     /db_xref="GeneID:502970"
                     /db_xref="RGD:1564505"
                     /translation="

MHTIKLLLFVVPLVISSRVDPDLSPFDSVPSEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQCFYDLSLQTNEIKEEEKELRRTTSKLQVKNEEVKNMSLELNSKLESLLEEKMALQHRVRALEEQLTSLVQNPPGAREHPEVTSLKSFVEQQDNSIRELLQSVEEQYKQLSQQHIQIKEIENQLRKTGIQEPTENSLYSKPRAPRTTPPLHLKEAKNIEQDDLPADCSAIYNRGEHTSGVYTIRPSSSQVFNVYCDTQSGTPRTLIQHRKDGSQNFNQTWENYEKGFGRLDGEFWLGLEKIYAIVKQSNYILRLELQDWKDSKHYAEYSFHLGNHETNYTLHVAEIAANIPEALPEHRDLMFSTWDHRAKGQLYCPESYSGGWWFSDMCGENNLNGKYNKPRAKSKPERRRGISWRPRGGKLYSIKSSKMMLQPTT"

     sig_peptide     56..103
                     /gene="Angptl3"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     misc_feature    <323..>670
                     /gene="Angptl3"
                     /note="Exopolysaccharide export protein/domain GumC/Wzc1
                     [Cell wall/membrane/envelope biogenesis]; Region: GumC;
                     COG3206"
                     /db_xref="CDD:442439"
     misc_feature    776..1414
                     /gene="Angptl3"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    1130..1132
                     /gene="Angptl3"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(1214..1216,1220..1222,1226..1228)
                     /gene="Angptl3"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(1235..1237,1244..1249,1277..1282)
                     /gene="Angptl3"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
     exon            551..661
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            662..776
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            777..890
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            891..986
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            987..1253
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
     exon            1254..1620
                     /gene="Angptl3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

tccttaccggaggaagacgttccaaattgcttgaaattgaataattgaaacaaaaatgcacacaattaagctgctcctttttgttgttcctctagtaatttcgtccagagttgatccagacctttcgccatttgattctgtaccgtcagagccaaaatcaagatttgctatgttggatgatgtcaaaattttagccaatggcctcctgcagctgggtcatggtcttaaagattttgtccataagacaaagggacaaattaatgacatatttcagaagctcaacatatttgatcagtgtttttatgacctatcacttcaaaccaatgaaatcaaagaagaggaaaaggagctaagaagaaccacatctaaactacaagttaaaaacgaagaggtgaagaatatgtcacttgaactgaactcaaagcttgaaagtctactggaggagaagatggcgctccaacacagagtcagggctttggaggaacagctgaccagcttggttcagaacccgcctggggctcgggagcacccagaggtaacgtcacttaaaagttttgtagaacagcaagataacagcataagagaactcctccagagtgtggaagaacaatataaacaactaagtcaacagcacattcagataaaagaaatagaaaatcagctcagaaagactggcattcaagaacccactgaaaattctctttattctaaaccaagagcaccaagaactactccccctcttcatctgaaggaagcaaaaaatatagaacaagatgatctgcctgctgactgctctgccatttataacagaggtgaacatacaagtggcgtgtatactattagaccaagcagctctcaagtgtttaatgtctactgtgacacccaatcaggcactccacggacattaattcaacaccggaaagatggctctcaaaacttcaaccaaacgtgggaaaactacgaaaagggttttgggaggcttgatggagaattctggttgggcctagagaagatctacgctatagtcaaacagtctaactacatcttacgactggagctacaagactggaaggacagcaagcactatgctgaatattcctttcatctgggcaatcatgaaaccaactacacgctacatgtggctgagattgctgccaatatccctgaggccctaccagaacacagagacctgatgttttctacatgggatcacagagcaaagggacagctctactgtccagaaagttattcaggtggctggtggttcagtgacatgtgtggagaaaacaacctaaatggtaaatacaacaaacccagagccaaatccaaaccagagcggagaagagggatctcctggaggcctcggggcggaaagctctactctatcaaatcatctaaaatgatgctccagccgaccacctaaggaagcgtcagctgaactgagacaaattaaaagaccaacacattcaatattaaaatccgcccgcacactgtagtacagcaatctggtattaaatctttagtggaaagcttaagaattgaatttcaattaactttaaagtcattgttaagatcagatatcattgcatcaatataacacaatttatattttcaatcaaa

//