GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 00:31:41, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001379180            5009 bp    mRNA    linear   PRI 30-AUG-2020
DEFINITION  Homo sapiens estrogen related receptor beta (ESRRB), transcript
            variant 2, mRNA.
ACCESSION   NM_001379180
VERSION     NM_001379180.1
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 5009)
  AUTHORS   Zheng R, Li Z, He F, Liu H, Chen J, Chen J, Xie X, Zhou J, Chen H,
            Wu X, Wu J, Chen B, Liu Y, Cui H, Fan L, Sha W, Liu Y, Wang J,
            Huang X, Zhang L, Xu F, Wang J, Feng Y, Qin L, Yang H, Liu Z, Cui
            Z, Liu F, Chen X, Gao S, Sun S, Shi Y and Ge B.
  TITLE     Genome-wide association study identifies two risk loci for
            tuberculosis in Han Chinese
  JOURNAL   Nat Commun 9 (1), 4072 (2018)
   PUBMED   30287856
  REMARK    GeneRIF: rs12437118 associated with tuberculosis risk in Han
            Chinese
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 5009)
  AUTHORS   Adachi K, Kopp W, Wu G, Heising S, Greber B, Stehling M,
            Arauzo-Bravo MJ, Boerno ST, Timmermann B, Vingron M and Scholer HR.
  TITLE     Esrrb Unlocks Silenced Enhancers for Reprogramming to Naive
            Pluripotency
  JOURNAL   Cell Stem Cell 23 (2), 266-275 (2018)
   PUBMED   29910149
  REMARK    GeneRIF: The orphan nuclear receptor Esrrb plays a pioneering role
            in recruiting the core pluripotency factors Oct4, Sox2, and Nanog
            to inactive enhancers in closed chromatin during the reprogramming
            of epiblast stem cells.
            Erratum:[Cell Stem Cell. 2018 Dec 6;23(6):900-904. PMID: 30526884]
REFERENCE   3  (bases 1 to 5009)
  AUTHORS   Kumari K, Adhya AK, Rath AK, Reddy PB and Mishra SK.
  TITLE     Estrogen-related receptors alpha, beta and gamma expression and
            function is associated with transcriptional repressor EZH2 in
            breast carcinoma
  JOURNAL   BMC Cancer 18 (1), 690 (2018)
   PUBMED   29940916
  REMARK    GeneRIF: EZH2 as a relevant coregulator for estrogen-related
            receptors alpha, beta and gamma in breast carcinoma.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 5009)
  AUTHORS   Madhu Krishna B, Chaudhary S, Mishra DR, Naik SK, Suklabaidya S,
            Adhya AK and Mishra SK.
  TITLE     Estrogen receptor alpha dependent regulation of estrogen related
            receptor beta and its role in cell cycle in breast cancer
  JOURNAL   BMC Cancer 18 (1), 607 (2018)
   PUBMED   29843638
  REMARK    GeneRIF: Study results indicate that ERRbeta is a negative
            regulator of cell cycle and a possible tumor suppressor in breast
            cancer.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 5009)
  AUTHORS   Quinelato V, Bonato LL, Vieira AR, Granjeiro JM, Tesch R and Casado
            PL.
  TITLE     Association Between Polymorphisms in the Genes of Estrogen
            Receptors and the Presence of Temporomandibular Disorders and
            Chronic Arthralgia
  JOURNAL   J. Oral Maxillofac. Surg. 76 (2), 314 (2018)
   PUBMED   29175417
  REMARK    GeneRIF: For the ESRRB (rs1676303) gene, an association was
            observed between the CC (cytosine/cytosine) genotype and the
            presence of articular TMDs associated with other chronic arthralgia
            (P = .02).
REFERENCE   6  (bases 1 to 5009)
  AUTHORS   Chen F, Zhang Q, McDonald T, Davidoff MJ, Bailey W, Bai C, Liu Q
            and Caskey CT.
  TITLE     Identification of two hERR2-related novel nuclear receptors
            utilizing bioinformatics and inverse PCR
  JOURNAL   Gene 228 (1-2), 101-109 (1999)
   PUBMED   10072763
REFERENCE   7  (bases 1 to 5009)
  AUTHORS   Enmark E, Pelto-Huikko M, Grandien K, Lagercrantz S, Lagercrantz J,
            Fried G, Nordenskjold M and Gustafsson JA.
  TITLE     Human estrogen receptor beta-gene structure, chromosomal
            localization, and expression pattern
  JOURNAL   J. Clin. Endocrinol. Metab. 82 (12), 4258-4265 (1997)
   PUBMED   9398750
REFERENCE   8  (bases 1 to 5009)
  AUTHORS   Sladek R, Beatty B, Squire J, Copeland NG, Gilbert DJ, Jenkins NA
            and Giguere V.
  TITLE     Chromosomal mapping of the human and murine orphan receptors
            ERRalpha (ESRRA) and ERRbeta (ESRRB) and identification of a novel
            human ERRalpha-related pseudogene
  JOURNAL   Genomics 45 (2), 320-326 (1997)
   PUBMED   9344655
REFERENCE   9  (bases 1 to 5009)
  AUTHORS   Shearer,A.E., Hildebrand,M.S. and Smith,R.J.H.
  TITLE     Hereditary Hearing Loss and Deafness Overview
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   20301607
REFERENCE   10 (bases 1 to 5009)
  AUTHORS   Giguere V, Yang N, Segui P and Evans RM.
  TITLE     Identification of a new class of steroid hormone receptors
  JOURNAL   Nature 331 (6151), 91-94 (1988)
   PUBMED   3267207
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC016543.6 and AC008050.6.
            
            Summary: This gene encodes a protein with similarity to the
            estrogen receptor. Its function is unknown; however, a similar
            protein in mouse plays an essential role in placental development.
            [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##RefSeq-Attributes-START##
            inferred exon combination :: based on alignments, homology
            MANE Ensembl match        :: ENST00000644823.1/ ENSP00000493776.1
            RefSeq Select criteria    :: based on manual assertion,
                                         conservation, expression
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-315               AC016543.6         81670-81984
            316-725             AC016543.6         144874-145283
            726-842             AC016543.6         168078-168194
            843-953             AC016543.6         187549-187659
            954-1115            AC016543.6         188131-188292
            1116-1385           AC008050.6         6324-6593
            1386-5009           AC008050.6         13091-16714
FEATURES             Location/Qualifiers
     source          1..5009
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q24.3"
     gene            1..5009
                     /gene="ESRRB"
                     /gene_synonym="DFNB35; ERR beta-2; ERR2; ERRb; ERRbeta2;
                     ESRL2; NR3B2"
                     /note="estrogen related receptor beta"
                     /db_xref="GeneID:2103"
                     /db_xref="HGNC:HGNC:3473"
                     /db_xref="MIM:602167"
     exon            1..315
                     /gene="ESRRB"
                     /gene_synonym="DFNB35; ERR beta-2; ERR2; ERRb; ERRbeta2;
                     ESRL2; NR3B2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    215..217
                     /gene="ESRRB"
                     /gene_synonym="DFNB35; ERR beta-2; ERR2; ERRb; ERRbeta2;
                     ESRL2; NR3B2"
                     /note="upstream in-frame stop codon"
     CDS             266..1630
                     /gene="ESRRB"
                     /gene_synonym="DFNB35; ERR beta-2; ERR2; ERRb; ERRbeta2;
                     ESRL2; NR3B2"
                     /note="isoform 2 is encoded by transcript variant 2;
                     steroid hormone receptor ERR2; estrogen receptor-like 2;
                     nuclear receptor ERRB2; orphan nuclear receptor; nuclear
                     receptor subfamily 3 group B member 2; estrogen-related
                     nuclear receptor beta"
                     /codon_start=1
                     /product="steroid hormone receptor ERR2 isoform 2"
                     /protein_id="NP_001366109.1"
                     /db_xref="GeneID:2103"
                     /db_xref="HGNC:HGNC:3473"
                     /db_xref="MIM:602167"
                     /translation="
MDVSELCIPDPLGYHNQLLNRMSSDDRHLGSSCGSFIKTEPSSPSSGIDALSHHSPSGSSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDSAIKCEYMLNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVSYLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV"
     exon            316..725
                     /gene="ESRRB"
                     /gene_synonym="DFNB35; ERR beta-2; ERR2; ERRb; ERRbeta2;
                     ESRL2; NR3B2"
                     /inference="alignment:Splign:2.1.0"
     exon            726..842
                     /gene="ESRRB"
                     /gene_synonym="DFNB35; ERR beta-2; ERR2; ERRb; ERRbeta2;
                     ESRL2; NR3B2"
                     /inference="alignment:Splign:2.1.0"
     exon            843..953
                     /gene="ESRRB"
                     /gene_synonym="DFNB35; ERR beta-2; ERR2; ERRb; ERRbeta2;
                     ESRL2; NR3B2"
                     /inference="alignment:Splign:2.1.0"
     exon            954..1115
                     /gene="ESRRB"
                     /gene_synonym="DFNB35; ERR beta-2; ERR2; ERRb; ERRbeta2;
                     ESRL2; NR3B2"
                     /inference="alignment:Splign:2.1.0"
     exon            1116..1385
                     /gene="ESRRB"
                     /gene_synonym="DFNB35; ERR beta-2; ERR2; ERRb; ERRbeta2;
                     ESRL2; NR3B2"
                     /inference="alignment:Splign:2.1.0"
     exon            1386..5009
                     /gene="ESRRB"
                     /gene_synonym="DFNB35; ERR beta-2; ERR2; ERRb; ERRbeta2;
                     ESRL2; NR3B2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aagtctcttgtgccccagcctcctccacggcttcgcatcccctctgcccgctctctccggagcgtgcggatgagtggagagctgggctgtgcgcgcacggctctctgcctccctctcccccgccgcggccgcctcctcccactctgcgttctcgcgctcactgtgccctgcccgggctcgcaccttgcccgtgcccttcactcgctcttccgcgtgatttccccgccgtctttctctaccaactgggaatgctaaaacgggactgatggacgtgtccgaactctgcatcccggaccccctcggctaccacaaccagctgctgaacaggatgtcctcggacgacaggcacctgggctccagctgcggctccttcatcaagactgagccgtccagcccgtcctcgggcatcgatgccctcagccaccacagccccagtggctcgtccgacgccagcggcggctttggcctggccctgggcacccacgccaacggtctggactcgccacccatgtttgcaggcgccgggctgggaggcaccccatgccgcaagagctacgaggactgtgccagcggcatcatggaggactcggccatcaagtgcgagtacatgctcaacgccatccccaagcgcctgtgcctcgtgtgcggggacattgcctctggctaccactacggcgtggcctcctgcgaggcttgcaaggccttcttcaagaggactatccaagggaacattgagtacagctgcccggccaccaacgagtgcgagatcaccaaacggaggcgcaagtcctgccaggcctgccgcttcatgaaatgcctcaaagtggggatgctgaaggaaggtgtgcgccttgatcgagtgcgtggaggccgtcagaaatacaagcgacggctggactcagagagcagcccatacctgagcttacaaatttctccacctgctaaaaagccattgaccaagattgtctcatacctactggtggctgagccggacaagctctatgccatgcctccccctggtatgcctgagggggacatcaaggccctgaccactctctgtgacctggcagaccgagagcttgtggtcatcattggctgggccaagcacatcccaggcttctcaagcctctccctgggggaccagatgagcctgctgcagagtgcctggatggaaatcctcatcctgggcatcgtgtaccgctcgctgccctatgacgacaagctggtgtacgctgaggactacatcatggatgaggagcactcccgcctcgcggggctgctggagctctaccgggccatcctgcagctggtacgcaggtacaagaagctcaaggtggagaaggaggagtttgtgacgctcaaggccctggccctcgccaactccgattccatgtacatcgaggatctagaggctgtccagaagctgcaggacctgctgcacgaggcactgcaggactacgagctgagccagcgccatgaggagccctggaggacgggcaagctgctgctgacactgccgctgctgcggcagacggccgccaaggccgtgcagcacttctatagcgtcaaactgcagggcaaagtgcccatgcacaaactcttcctggagatgctggaggccaaggtgtgatggccccgcacacggaccaatgcccacctacagacagacaaacggacagaccgaggtggagacctccacagccaccagcctccaccttcaacccctgtatcatggctctgagctgtcccagaggcgggggtttctcacctcctggctgtgtgcagactcccgggtgcagtggggtgggggacggggatgggggggcaggggtgtggggctcgactgtaactggctttttctttggtatgtctttccttctccatggacggtgcggaggcctgggccagggctgactcccttcaggagtggaggccactggagcaagtgccctctcccctccaccgagccaccaagaggcagcatgtgcatttcctaactcccttgccccctcccccatctgtggcctgggtgggcactgctcaggctggataccacctggaggttttccttccgcagagggcaggtacgcaagggacaacagtatctttcttccagaggtcctacctgctctgagatcctctggggccggtcaagaggccccataccttccacagtttccactcagctttcagccagggggtacccacaggagagcagcggctagagctcaagtgcttcctgggcaccccacccctcggggcctacccccctgcctgtcacccaccgcgccggtgtccacctgtcctcctcctcttctcctccccccgggagtcccccgctacttcctgaccctacctcagagctcactcacccagtgggttcagccagccacagcgactccaggggctgtagacaggaacgcgctggcacagagaagagcggggaccacaccatcctcccaagaaccctctccctcttcctgccttccccctctccctgaagggcaggtccaggccaagtgagcctgtgagaagctcaggagcctggctccatccaagagcaccccggggggaggatcaggacaggatggacagaggcccagactcatctttgccaagcacagaaaggccgagcagctgagataagtaggcaggggagccccaaagggagggaactcagcggggtggcctgcctcatccttcctggcttcccttccctgcactcagcatcatgccacagggctagtgtaccagtgccacaggaggggtgccctcctaccacacttgggctaccagaggtttggtgtagctcccctgggcaccgcgagcacgccagctctctggcaggacccctgcagtccccctggctgtgccaggtaaccaaccgtcttggtttgtccaggacgtttctttatcccaggaaactcctctaccccaggcacacggggacagtgggtcactctatttctgtggatggccgtgaaagttttcactaactcaaggggcagccctgaacacccatttgtgctcacaggttggccaagagcagcttagaggatctcccaaggatgaaagaatgtcaagccatgatggaaaatgccccttccaatcagctgccttcacaagcagggatcagagcaactccccggggatccccaatccacgcccttctagtccaacccccctcaatgagagaggcaggcagatctcacccagcactaggacaccaggaggccaggtaactttctgcagcttttccatagaagccctggtcccacctccttggctctaccccaggaacctcccggcctgggcttctgggctgggacgtgctgaggtcatcccagacaggagggagggctggctgaaatccacaaactgcagagcagctctctgatggtgtcccacacagaaaatgttaaggatttcaagagccctcccagaccagtgatgtgtccctccggctccccttgcctgtggggaatcgggtctgagtcacttgatgagtaggcactggagccgttacccaggatgctgcggccctagccctccatgcagcccatcttccctcatttgggtggaggcacacatttggggcaaaggccccttcttggcatcaaggaacaccagctacaaaccaagtctagcacagtgtttagaggctctgccctgaggttctgctccggagaaaccttcacagtagagaccttggggtgtgtgctttgggactccctcagtctctcactgtgctgtgtccttgcagcggggccgaggtagcaccctgctctgtcacttcctgctcaagctggaggacccaggcggcagggcatcatgcccagctggcatctgctgtctgtcttttctagggaaagcatctctggctcaccatgtaacatctggcttggagcaagtgggtgttctgcacaccaggcagctgcacctcactggatctagtgttgctgcgagtgacctcacttcagagcccctctagcagagtggggcggaagtcctgatggttggtgtccatgaggtggaagctgcttttatacttaaaactcagatcacaacaggaaatgtgtcagtaacaatggaactccatccaatgggaaagttcctggtactgaaggggtccattggacactcagaaaagaagttcaggggccaacttcttagctggaatcctggccagatgaggaccctctccggggaagggagaggactgacttagtggaaggtggtgaagtgaggagagtttaggggaaccttcccccagtggaacagatctcaagtttaccctaaacctgccatttctggaaaatctgtaaagaggaaacagcctgtctcagctgtactctcatgatacaggtcatttgaaatgaaccaagaaataaaacatgaaaatccaaccatggagaaggtggtatggctgggttttgtttggtccccttgtccttatacgttctaaagtttccagactggctttgtcactttgtgaactcgtcatgtgtgaaaaccaatctttgcatatagggaacttcctcgggccacactttaagaaccaagtaagaggctctcaagactccagcagagtcgggaggccatggcagcgccttagaggagctggaacctgcacccacctgtgtcggtggggggggcctcctttccccatagactctgccctccctctgtgcagatggaagtggcaggggagggtgaccagcttgtgacaagaagactgaagggtccagagtccatgctcacggaacagcaccaaagaaaagcactatgtggaaagattgttttattttctaataatgataatatggctggaatggcttcttaagatgtatatattttttaaaatggcagttccccattgcagcatcacctacttgtatgtctttctgcctctgtatatgttctcccagaaacccccatgtaaatcaaatgccctaggatgcttccatcctggtcccatgtatctggaatctaataaataaggaaaggaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]