GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 01:08:53, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001366333            1687 bp    mRNA    linear   PRI 31-AUG-2020
DEFINITION  Homo sapiens ZFP57 zinc finger protein (ZFP57), transcript variant
            2, mRNA.
ACCESSION   NM_001366333 XM_006715087
VERSION     NM_001366333.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1687)
  AUTHORS   Shoji Y, Takamura H, Ninomiya I, Fushida S, Tada Y, Yokota T, Ohta
            T and Koide H.
  TITLE     The Embryonic Stem Cell-Specific Transcription Factor ZFP57
            Promotes Liver Metastasis of Colorectal Cancer
  JOURNAL   J. Surg. Res. 237, 22-29 (2019)
   PUBMED   30694787
  REMARK    GeneRIF: Study demonstrated that ZFP57 plays an important role in
            the hematogenous metastasis of colorectal cancer, suggesting that
            it could be used as a novel treatment target. The expression level
            of ZFP57 was significantly correlated with that of the
            metastasis-related gene NANOG and ZFP57 overexpression reduced the
            progression-free survival rate of patients with colorectal cancer.
REFERENCE   2  (bases 1 to 1687)
  AUTHORS   Chen L, Wu X, Xie H, Yao N, Xia Y, Ma G, Qian M, Ge H, Cui Y, Huang
            Y, Wang S and Zheng M.
  TITLE     ZFP57 suppress proliferation of breast cancer cells through
            down-regulation of MEST-mediated Wnt/beta-catenin signalling
            pathway
  JOURNAL   Cell Death Dis 10 (3), 169 (2019)
   PUBMED   30787268
  REMARK    GeneRIF: ZFP57-MEST and the Wnt/beta-catenin pathway axis are
            involved in breast tumorigenesis, which may represent a potential
            diagnostic biomarker, and provide a new insight into a novel
            therapeutic strategy for breast cancer patients.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1687)
  AUTHORS   Takahashi N, Coluccio A, Thorball CW, Planet E, Shi H, Offner S,
            Turelli P, Imbeault M, Ferguson-Smith AC and Trono D.
  TITLE     ZNF445 is a primary regulator of genomic imprinting
  JOURNAL   Genes Dev. 33 (1-2), 49-54 (2019)
   PUBMED   30602440
REFERENCE   4  (bases 1 to 1687)
  AUTHORS   Sparago A, Cerrato F and Riccio A.
  TITLE     Is ZFP57 binding to H19/IGF2:IG-DMR affected in Silver-Russell
            syndrome?
  JOURNAL   Clin Epigenetics 10, 23 (2018)
   PUBMED   29484033
  REMARK    GeneRIF: Data propose that paternal deletions are associated with
            Silver-Russell syndrome when ZFP57 binding is affected and this
            happens when one of the three ZFP57 binding regions to H19/IGF2
            intergenic differentially methylated region is lost.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1687)
  AUTHORS   Bak M, Boonen SE, Dahl C, Hahnemann JM, Mackay DJ, Tumer Z,
            Gronskov K, Temple IK, Guldberg P and Tommerup N.
  TITLE     Genome-wide DNA methylation analysis of transient neonatal diabetes
            type 1 patients with mutations in ZFP57
  JOURNAL   BMC Med. Genet. 17, 29 (2016)
   PUBMED   27075368
  REMARK    GeneRIF: transient neonatal diabetes type 1 is associated with
            ZFP57 mutations
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1687)
  AUTHORS   Li X, Ito M, Zhou F, Youngson N, Zuo X, Leder P and Ferguson-Smith
            AC.
  TITLE     A maternal-zygotic effect gene, Zfp57, maintains both maternal and
            paternal imprints
  JOURNAL   Dev. Cell 15 (4), 547-557 (2008)
   PUBMED   18854139
REFERENCE   7  (bases 1 to 1687)
  AUTHORS   Mackay DJ, Callaway JL, Marks SM, White HE, Acerini CL, Boonen SE,
            Dayanikli P, Firth HV, Goodship JA, Haemers AP, Hahnemann JM,
            Kordonouri O, Masoud AF, Oestergaard E, Storr J, Ellard S,
            Hattersley AT, Robinson DO and Temple IK.
  TITLE     Hypomethylation of multiple imprinted loci in individuals with
            transient neonatal diabetes is associated with mutations in ZFP57
  JOURNAL   Nat. Genet. 40 (8), 949-951 (2008)
   PUBMED   18622393
  REMARK    GeneRIF: Study reports mutations in ZFP57, which encodes a
            zinc-finger transcription factor expressed in early development, in
            seven pedigrees with a shared pattern of mosaic hypomethylation and
            a conserved range of clinical features.
REFERENCE   8  (bases 1 to 1687)
  AUTHORS   Alonso MB, Zoidl G, Taveggia C, Bosse F, Zoidl C, Rahman M,
            Parmantier E, Dean CH, Harris BS, Wrabetz L, Muller HW, Jessen KR
            and Mirsky R.
  TITLE     Identification and characterization of ZFP-57, a novel zinc finger
            transcription factor in the mammalian peripheral nervous system
  JOURNAL   J. Biol. Chem. 279 (24), 25653-25664 (2004)
   PUBMED   15070898
REFERENCE   9  (bases 1 to 1687)
  AUTHORS   Okazaki S, Tanase S, Choudhury BK, Setoyama K, Miura R, Ogawa M and
            Setoyama C.
  TITLE     A novel nuclear protein with zinc fingers down-regulated during
            early mammalian cell differentiation
  JOURNAL   J. Biol. Chem. 269 (9), 6900-6907 (1994)
   PUBMED   8120052
REFERENCE   10 (bases 1 to 1687)
  AUTHORS   Temple,I.K. and Mackay,D.J.G.
  TITLE     Diabetes Mellitus, 6q24-Related Transient Neonatal
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   20301706
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL645936.5.
            On Jun 2, 2019 this sequence version replaced NM_001366333.1.
            
            Summary: The protein encoded by this gene is a zinc finger protein
            containing a KRAB domain. Studies in mouse suggest that this
            protein may function as a transcriptional repressor. Mutations in
            this gene have been associated with transient neonatal diabetes
            mellitus type 1 (TNDM1).[provided by RefSeq, Sep 2009].
            
            Transcript Variant: This variant (2) lacks an alternate exon
            compared to variant 1. The resulting isoform (2) is shorter at the
            N-terminus compared to isoform 1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR5189655.48889.1,
                                           SRR5189655.167773.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA1965299, SAMEA1968540
                                           [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-91                AL645936.5         132048-132138       c
            92-218              AL645936.5         126919-127045       c
            219-320             AL645936.5         126372-126473       c
            321-1687            AL645936.5         123378-124744       c
FEATURES             Location/Qualifiers
     source          1..1687
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6p22.1"
     gene            1..1687
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="ZFP57 zinc finger protein"
                     /db_xref="GeneID:346171"
                     /db_xref="HGNC:HGNC:18791"
                     /db_xref="MIM:612192"
     exon            1..91
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /inference="alignment:Splign:2.1.0"
     variation       4
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:900415574"
     variation       7
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1395846905"
     variation       11
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377436452"
     variation       14
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944526204"
     variation       19
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237975289"
     variation       20
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1308631301"
     variation       23
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:911741546"
     variation       24
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1312915772"
     variation       25
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1042096521"
     variation       28
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1254527315"
     variation       29
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:945130687"
     variation       35
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2747432"
     variation       38
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1202823192"
     variation       43
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978493866"
     variation       44
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968425423"
     variation       45
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:989096420"
     variation       46
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237022199"
     variation       47
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:959068610"
     variation       54
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1433310222"
     variation       55
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1177745924"
     variation       56
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1375600987"
     misc_feature    65..67
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="upstream in-frame stop codon"
     variation       72
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1465810702"
     variation       80
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:927515715"
     variation       82
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1403000827"
     variation       83
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363983965"
     variation       85
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:538637425"
     variation       90
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1010400183"
     exon            92..218
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /inference="alignment:Splign:2.1.0"
     variation       96
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:574707884"
     variation       97
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374295115"
     variation       100
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371178364"
     variation       105
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562226131"
     variation       116
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1202743486"
     variation       118
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1482556690"
     variation       124
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377042735"
     variation       131
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1305176738"
     variation       150
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773388964"
     variation       151
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375456558"
     variation       153
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:748718399"
     variation       158
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218225400"
     variation       159
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1325682251"
     variation       160
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779376984"
     variation       166
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1234019681"
     variation       174
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:755350593"
     variation       176
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1275852223"
     variation       177
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:191653089"
     CDS             185..1579
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="isoform 2 is encoded by transcript variant 2; zinc
                     finger protein 57 homolog; zfp-57; zinc finger protein
                     698"
                     /codon_start=1
                     /product="zinc finger protein 57 homolog isoform 2"
                     /protein_id="NP_001353262.1"
                     /db_xref="GeneID:346171"
                     /db_xref="HGNC:HGNC:18791"
                     /db_xref="MIM:612192"
                     /translation="
MSETFKNLTSVARIFLHKPELITKLEQEEEQWREFVHLPNTEGLSEGKKKELREQHPSLRDEGTSDDKVFLACRGAGQCPLSAPAGTMDRTRVLQASQAGPPFFCYTCGKCFSRRSYLYSHQFVHNPKLTNSCSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTYCDASGLSRHRRVHLGYRPHSCSVCGKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTQAEFQTPIARSQRSIQGLLDVNHAPVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAPITGTLCQDARSNSHPVKPSRLNVFCCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKSFSSFSRLVRHQQTHWKQKSYLCPICDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILGQWLGFSHDVPTMAGEEWKHGGDQSPPRIHTPRRRGLREKACKGDKTKEAVSILKHK"
     misc_feature    <185..280
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="KRAB (Kruppel-associated box) domain -A box;
                     Region: KRAB_A-box; cl02581"
                     /db_xref="CDD:322003"
     misc_feature    497..559
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(497..499,506..508,545..547,557..559)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    <521..1258
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="FOG: Zn-finger [General function prediction only];
                     Region: COG5048"
                     /db_xref="CDD:227381"
     misc_feature    581..643
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(581..583,590..592,629..631,641..643)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    order(596..598,602..604,608..610,614..619,626..631,
                     638..640,680..682,686..688,698..703,710..715,722..724,
                     764..766,770..772,776..778,782..787,794..799,806..808)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    665..727
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(665..667,674..676,713..715,725..727)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    749..811
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(749..751,758..760,797..799,809..811)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1124..1186
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1124..1126,1133..1135,1172..1174,1184..1186)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    order(1139..1141,1145..1147,1151..1153,1157..1162,
                     1169..1174,1181..1183,1223..1225,1229..1231,1241..1246,
                     1253..1258,1265..1267,1307..1309,1313..1315,1319..1321,
                     1325..1330,1337..1342)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1208..1270
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(1208..1210,1217..1219,1256..1258,1268..1270)
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    1292..1348
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     variation       186
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749602208"
     variation       189
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:186800938"
     variation       190..197
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="ggaaacct"
                     /db_xref="dbSNP:776117155"
     variation       190
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546769900"
     variation       195..196
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1583179644"
     variation       195
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458704903"
     variation       201..213
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="agaatctaacatc"
                     /db_xref="dbSNP:770056554"
     variation       205
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:750025018"
     variation       214
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1562225992"
     variation       215
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474857805"
     exon            219..320
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /inference="alignment:Splign:2.1.0"
     variation       227
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774843855"
     variation       229
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1346592440"
     variation       234
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1444492534"
     variation       239
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1384983515"
     variation       241
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373052417"
     variation       243
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442084428"
     variation       245
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369213004"
     variation       248
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:780517451"
     variation       250
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377556293"
     variation       253
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373253380"
     variation       256
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745602868"
     variation       257
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369717350"
     variation       267..268
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:776707255"
     variation       270
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756845030"
     variation       280..286
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="gag"
                     /replace="gagag"
                     /replace="gagagag"
                     /db_xref="dbSNP:606231121"
     variation       283
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:751070267"
     variation       286
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249349485"
     variation       287
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777872562"
     variation       288
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1277272289"
     variation       289
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:758407681"
     variation       290
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1331351012"
     variation       301
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752544644"
     variation       305
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765144886"
     variation       315..317
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1229065582"
     exon            321..1687
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /inference="alignment:Splign:2.1.0"
     variation       325
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1276106077"
     variation       332
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1221373524"
     variation       339..340
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1344415728"
     variation       342
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:114591600"
     variation       352
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:971469760"
     variation       353
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746634665"
     variation       355
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374760825"
     variation       361..366
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="gaga"
                     /replace="gagaga"
                     /db_xref="dbSNP:747207653"
     variation       367
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:922250508"
     variation       368
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1241267382"
     variation       369
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:777578657"
     variation       369
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1318298375"
     variation       373
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1319542001"
     variation       375
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757840663"
     variation       377
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752735462"
     variation       381
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1480239392"
     variation       382
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1196716120"
     variation       393
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1424559396"
     variation       394
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194148394"
     variation       396
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1277703799"
     variation       398
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778657283"
     variation       400
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1247295402"
     variation       402
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:964122823"
     variation       407
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983459674"
     variation       409
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754805449"
     variation       410
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354005915"
     variation       412
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767749722"
     variation       413
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280148044"
     variation       416
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:762074022"
     variation       417
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1190848529"
     variation       418
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1322433624"
     variation       421..425
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:771827176"
     variation       421
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1278377025"
     variation       423
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1220060178"
     variation       424
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751750269"
     variation       426
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:748137597"
     variation       427
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1027550840"
     variation       434
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1269974330"
     variation       442
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764303925"
     variation       443
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201703858"
     variation       444
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1334830817"
     variation       447
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1301617154"
     variation       451
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776081525"
     variation       452
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:968875761"
     variation       454
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765599364"
     variation       458
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759998407"
     variation       459
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200541066"
     variation       463
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771387494"
     variation       467
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185661286"
     variation       472
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746724268"
     variation       477
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1239089042"
     variation       482
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772724131"
     variation       486
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:771624086"
     variation       490
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542920653"
     variation       491..497
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="tttttt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:1272756745"
     variation       491
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:778941830"
     variation       493
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754861035"
     variation       495
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:749203567"
     variation       500
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146835830"
     variation       503
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001655263"
     variation       504
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1340163210"
     variation       511
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1009205764"
     variation       521
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755902229"
     variation       523
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:563761778"
     variation       527
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61730330"
     variation       528
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1452510913"
     variation       531
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:936245337"
     variation       539
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764169187"
     variation       540
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368581073"
     variation       541
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1354091793"
     variation       546
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1490718219"
     variation       547
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374182967"
     variation       548
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371536651"
     variation       549
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760158033"
     variation       559
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405687782"
     variation       561
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:9461544"
     variation       562
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1422933793"
     variation       570
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:375036402"
     variation       571
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761061868"
     variation       572
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772922271"
     variation       573
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771584295"
     variation       579
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747717587"
     variation       587
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370274313"
     variation       589
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749291665"
     variation       590
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:950226844"
     variation       591
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323921002"
     variation       601
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1290038738"
     variation       604
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779957149"
     variation       605
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755918943"
     variation       606
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917312314"
     variation       611
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745587750"
     variation       613
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1389706595"
     variation       617
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:778091529"
     variation       620
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1372896975"
     variation       626
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1294388360"
     variation       627
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438833770"
     variation       635
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758594645"
     variation       636
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752929320"
     variation       640
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1378857611"
     variation       641
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237765445"
     variation       647
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1583175309"
     variation       654..655
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1423947997"
     variation       654
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983961658"
     variation       655
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:574779981"
     variation       663
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1040682124"
     variation       669
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181230141"
     variation       670
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211596222"
     variation       672
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1160694383"
     variation       674
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755094030"
     variation       675
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249176934"
     variation       679
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754408148"
     variation       682
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562221844"
     variation       684
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1489250818"
     variation       689
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1253767105"
     variation       691
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:387906227"
     variation       692
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1554211826"
     variation       700
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190197921"
     variation       705
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1222131878"
     variation       710
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488922640"
     variation       711
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77625743"
     variation       716
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750705477"
     variation       717
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199589695"
     variation       719
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761414885"
     variation       720
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774050037"
     variation       721
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768216433"
     variation       722
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762393813"
     variation       726
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173982165"
     variation       729
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1358685458"
     variation       730
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1404065735"
     variation       732
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1361113486"
     variation       736
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775414598"
     variation       737
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1451540089"
     variation       738..739
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1562221637"
     variation       738
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1362771214"
     variation       741
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769683397"
     variation       747
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868001962"
     variation       748
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1481218759"
     variation       749
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1426725604"
     variation       751..754
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1368158770"
     variation       751
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61730328"
     variation       753
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1488848205"
     variation       756
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780884858"
     variation       766
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886061285"
     variation       772
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562221514"
     variation       773
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770753045"
     variation       774
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:796913217"
     variation       779
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1485817791"
     variation       787
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256677166"
     variation       792
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1311114068"
     variation       794
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:552912198"
     variation       795
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748373430"
     variation       797
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78378398"
     variation       801
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780783557"
     variation       802
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562221400"
     variation       806
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1219448045"
     variation       807
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1481245261"
     variation       808
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1340970637"
     variation       809
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198384465"
     variation       811
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141297510"
     variation       812
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1583174731"
     variation       817
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1380473448"
     variation       820
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:267600939"
     variation       821
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745806203"
     variation       825
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753928819"
     variation       831
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:954556811"
     variation       837
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020677270"
     variation       838
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780728839"
     variation       839
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200369502"
     variation       844
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756629358"
     variation       845
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750911552"
     variation       847
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562221212"
     variation       848
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562221195"
     variation       849
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:893438668"
     variation       853
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1032415764"
     variation       855
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1001893815"
     variation       857
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:970043595"
     variation       860..873
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ccaggc"
                     /replace="ccaggcacccaggc"
                     /db_xref="dbSNP:606231123"
     variation       860
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1428444822"
     variation       861
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767837891"
     variation       864
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562221096"
     variation       865
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:567544440"
     variation       869
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1465324835"
     variation       871
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1016766761"
     variation       875
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1350262686"
     variation       877
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369847099"
     variation       880
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1446298140"
     variation       882
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1291699041"
     variation       883
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1366900421"
     variation       887..895
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="cc"
                     /replace="cccatcgcc"
                     /db_xref="dbSNP:778814024"
     variation       887
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1400043837"
     variation       892
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262586492"
     variation       893
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763672670"
     variation       894
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778620158"
     variation       896
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1252862738"
     variation       897
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224922089"
     variation       904
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:906101853"
     variation       905
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61730327"
     variation       906
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769259227"
     variation       909
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759455258"
     variation       911
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:994080864"
     variation       913
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:61730329"
     variation       914
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776614741"
     variation       918
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1335472515"
     variation       919
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1465826374"
     variation       923
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770642322"
     variation       926
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1166547350"
     variation       930
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746751205"
     variation       931
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779308295"
     variation       933
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1166093143"
     variation       937
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768950408"
     variation       940
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1488932486"
     variation       941
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749499233"
     variation       944
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746760385"
     variation       947
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1583174244"
     variation       959
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368879630"
     variation       962
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750951540"
     variation       965
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:781684257"
     variation       966
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889430650"
     variation       973
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1292220386"
     variation       977
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757570725"
     variation       985
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751884998"
     variation       989
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1406870266"
     variation       991
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763762727"
     variation       992
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1446826654"
     variation       994
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1337184269"
     variation       996
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:777685594"
     variation       999
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758082902"
     variation       1001
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200537697"
     variation       1004
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:764708577"
     variation       1005
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165798284"
     variation       1009
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1299452041"
     variation       1013
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759027006"
     variation       1022
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1385118076"
     variation       1028
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1429251073"
     variation       1038
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1284420667"
     variation       1041
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:776435097"
     variation       1052
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:766297919"
     variation       1053
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1226944437"
     variation       1054
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61730326"
     variation       1062
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1470651997"
     variation       1063
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1562220388"
     variation       1069
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202183128"
     variation       1070
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1452388816"
     variation       1071
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2535241"
     variation       1075
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224349155"
     variation       1077
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185359504"
     variation       1079
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290881979"
     variation       1080
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:559348023"
     variation       1086
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:193232883"
     variation       1096
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745896871"
     variation       1102
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:987366144"
     variation       1104
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781584552"
     variation       1115
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:529598384"
     variation       1116
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747496113"
     variation       1117
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1184548139"
     variation       1120
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1305373867"
     variation       1122
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1403442926"
     variation       1124
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1471959854"
     variation       1127
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144633545"
     variation       1129
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758744824"
     variation       1130
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1402953555"
     variation       1131
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752357427"
     variation       1132
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764874679"
     variation       1135..1140
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="tt"
                     /replace="ttcttt"
                     /db_xref="dbSNP:754874675"
     variation       1135
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1583173719"
     variation       1149
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754475305"
     variation       1164
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:753338450"
     variation       1170
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:543657387"
     variation       1180
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1267879910"
     variation       1182
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2535242"
     variation       1191
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420157851"
     variation       1194
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:534295137"
     variation       1197
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773279387"
     variation       1198
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:578187010"
     variation       1202
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1334300140"
     variation       1208
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1360487434"
     variation       1210
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1445404101"
     variation       1219
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:958024543"
     variation       1222
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1241317973"
     variation       1225
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761644594"
     variation       1227
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775582817"
     variation       1229
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:544556724"
     variation       1232
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221276996"
     variation       1244
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:745960774"
     variation       1246
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776825648"
     variation       1247
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747569394"
     variation       1248
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1343877566"
     variation       1250
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758763239"
     variation       1251
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:753298748"
     variation       1251
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1415060975"
     variation       1255
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748470752"
     variation       1258
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778450859"
     variation       1261
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1353665581"
     variation       1265
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754707433"
     variation       1270
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1562219731"
     variation       1272
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1308237428"
     variation       1275
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753401097"
     variation       1280
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371992141"
     variation       1282
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755672721"
     variation       1288
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750984855"
     variation       1289
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:564988086"
     variation       1295
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209685547"
     variation       1297
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761734387"
     variation       1298
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1201455297"
     variation       1300
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:59871039"
     variation       1307
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751322940"
     variation       1308
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1274151032"
     variation       1317
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763778116"
     variation       1326
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:759846876"
     variation       1327
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776700228"
     variation       1329
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771009420"
     variation       1331
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1378380148"
     variation       1338
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1469586178"
     variation       1340
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:79020217"
     variation       1348
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368647820"
     variation       1351
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:606231122"
     variation       1354
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760678264"
     variation       1357
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773736935"
     variation       1358
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1426675317"
     variation       1364
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1339349810"
     variation       1366
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1335662355"
     variation       1372..1373
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:779565308"
     variation       1377
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993966100"
     variation       1384
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1355295275"
     variation       1385
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772517149"
     variation       1394
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190525528"
     variation       1395
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779374306"
     variation       1396
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1167336463"
     variation       1397
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1276621351"
     variation       1403
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1342976931"
     variation       1409
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1445158078"
     variation       1411
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1244454117"
     variation       1418
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1181136742"
     variation       1420
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1019964083"
     variation       1423
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460618831"
     variation       1427
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768898589"
     variation       1429
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1206154386"
     variation       1431
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1023184421"
     variation       1433
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1272737158"
     variation       1436
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1247421177"
     variation       1440
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184974475"
     variation       1443
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1313049165"
     variation       1445
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779516588"
     variation       1446
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379362378"
     variation       1448
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755691087"
     variation       1451
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300159881"
     variation       1453
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749915090"
     variation       1455
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188715625"
     variation       1466
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781303296"
     variation       1469
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:896106578"
     variation       1477
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757316381"
     variation       1479
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1048360904"
     variation       1481..1486
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:1562218802"
     variation       1482..1505
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="cccccagga"
                     /replace="cccccaggatccatacccccagga"
                     /db_xref="dbSNP:750068333"
     variation       1484
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764004089"
     variation       1485
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993701924"
     variation       1486
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754092341"
     variation       1487
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562218757"
     variation       1488
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147411133"
     variation       1491
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1422777845"
     variation       1497..1501
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:755751642"
     variation       1497
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773321909"
     variation       1498
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:772117596"
     variation       1499
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762440334"
     variation       1500
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774715942"
     variation       1501
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769068037"
     variation       1503
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866369559"
     variation       1507
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:943349344"
     variation       1511
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1326093620"
     variation       1512
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749555948"
     variation       1513..1514
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:764601710"
     variation       1513
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:797046123"
     variation       1518
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775303301"
     variation       1521
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:769528747"
     variation       1526
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1222298541"
     variation       1527
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1372785368"
     variation       1535
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745482780"
     variation       1540
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1405276138"
     variation       1548..1553
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="agg"
                     /replace="aggagg"
                     /db_xref="dbSNP:1345328002"
     variation       1548
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780894497"
     variation       1550
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:572960141"
     variation       1552
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1217039986"
     variation       1553
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:575606060"
     variation       1565
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542605540"
     variation       1571
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:913859647"
     variation       1572..1581
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="ataaat"
                     /replace="ataaataaat"
                     /db_xref="dbSNP:1269341773"
     variation       1572
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79455213"
     variation       1573
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752397345"
     variation       1577
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1583172159"
     variation       1583
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764988283"
     variation       1585
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1199672355"
     variation       1587
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756378639"
     variation       1597
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:925001776"
     variation       1607
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1168109446"
     variation       1608
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750631415"
     variation       1609
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200574995"
     variation       1619
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414193184"
     variation       1621
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1583172044"
     variation       1623..1625
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="gag"
                     /db_xref="dbSNP:1262576730"
     variation       1625
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761731922"
     variation       1634
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149736421"
     variation       1637
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:969010282"
     variation       1645
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1165403510"
     variation       1654
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1562218047"
     variation       1655
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1389144156"
     variation       1666
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1424621412"
     variation       1668
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763863050"
     variation       1671
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1413354788"
     variation       1672
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747831237"
     variation       1678
                     /gene="ZFP57"
                     /gene_synonym="bA145L22; bA145L22.2; C6orf40; TNDM1;
                     ZNF698"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1398295157"
ORIGIN      
gccgggactgcgggtgctcggccggagcgctccagccgctggtccccgggagaccctgtgcccctaaatcgcggtccactgcgcgcgtcagaagccagtcacctttgaggatgtggcagtgaatttcacccaggaagagtgggactgtctagatgccagccagagggtcctttaccaggatgttatgtcggaaacctttaagaatctaacatctgtggccagaatctttctgcataagccagagctaatcaccaagcttgagcaagaagaggaacagtggagagagtttgtccatctcccaaacacagaaggcctttcagaaggcaagaagaaagagcttcgagaacaacatcccagtctgagagatgaggggactagtgatgacaaggtcttccttgcatgcagaggggccggccagtgccccctatctgccccagctgggactatggacaggacccgggtgcttcaagcatcccaggctgggccaccctttttttgctacacctgtggcaaatgtttcagcaggcgctcctacctctatagccaccagtttgttcacaatcccaagctgactaacagctgcagtcagtgtgggaagttgtttcggagccccaagtccctcagctatcacagacgcatgcatcttggggagaggcccttctgttgcacgctctgtgacaagacctactgtgatgcttctggactaagtcgtcaccgccgcgtccatctgggttaccggccccattcatgctctgtgtgtgggaagagcttccgggaccagtctgagctcaaacgccaccagaagatacaccaaaaccaggagccagtggatggaaaccaggagtgtactttgaggattccaggcacccaggctgaattccagacacccatcgccagaagccagaggtccatccaggggcttttggatgtgaaccatgcaccagtggccaggtcccaggaacccatatttagaactgagggtcctatggcccagaaccaggcatctgtacttaagaaccaagcacctgtgaccaggacccaggcacccatcactggaaccctctgtcaggatgccagatccaactctcatccagtgaagccctcaagactcaatgtcttctgttgcccccattgttctttgacttttagcaagaaatcctatctctccagacaccagaaggcccacctcacagagccgcccaactactgcttccattgcagcaagtctttcagctcattttccaggctggtcagacaccagcagacccactggaagcagaagagctacctttgccctatctgtgacctctcctttggggagaaagagggccttatggatcactggaggggctataaaggcaaggacctgtgccagagcagccaccataaatgccgggtgatcctgggccagtggcttggcttctctcatgatgtccccactatggctggggaggaatggaagcatggaggtgatcaatctccccccaggatccatacccccaggagaagaggcctaagagagaaggcctgcaaaggagacaaaacaaaggaggcagtgagcatcttgaaacataaataaatggcctttctgactgagctctttctttgtgtttagttttcctgaggactgacctctggggtaatgaggctggagtagagggagacaggtgcgtggataaggaaggaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]