GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 03:58:51, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001355281            1886 bp    mRNA    linear   PRI 11-JUL-2020
DEFINITION  Homo sapiens Nanog homeobox retrogene P8 (NANOGP8), mRNA.
ACCESSION   NM_001355281
VERSION     NM_001355281.2
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1886)
  AUTHORS   Ma X, Wang B, Wang X, Luo Y and Fan W.
  TITLE     NANOGP8 is the key regulator of stemness, EMT, Wnt pathway,
            chemoresistance, and other malignant phenotypes in gastric cancer
            cells
  JOURNAL   PLoS ONE 13 (4), e0192436 (2018)
   PUBMED   29689047
  REMARK    GeneRIF: NANOGP8 is the main regulator of gastric cancer stem
            cells. NANOGP8 is correlated with cell proliferation, migration,
            invasion, clonogenic capacity, beta-catenin accumulation in
            nucleus, and chemoresistance in gastric cancer.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1886)
  AUTHORS   Wang R, Bhattacharya R, Ye X, Fan F, Boulbes DR, Xia L and Ellis
            LM.
  TITLE     Endothelial cells activate the cancer stem cell-associated NANOGP8
            pathway in colorectal cancer cells in a paracrine fashion
  JOURNAL   Mol Oncol 11 (8), 1023-1034 (2017)
   PUBMED   28453235
  REMARK    GeneRIF: studies demonstrated a paracrine role for endothelial
            cells in regulating the cancer stem cells phenotype and
            chemoresistance in colorectal cancer cells by AKT-mediated
            induction of NANOGP8.
REFERENCE   3  (bases 1 to 1886)
  AUTHORS   Wang B, Chen Q, Cao Y, Ma X, Yin C, Jia Y, Zang A and Fan W.
  TITLE     LGR5 Is a Gastric Cancer Stem Cell Marker Associated with Stemness
            and the EMT Signature Genes NANOG, NANOGP8, PRRX1, TWIST1, and BMI1
  JOURNAL   PLoS ONE 11 (12), e0168904 (2016)
   PUBMED   28033430
  REMARK    GeneRIF: LGR5-expressing fraction of CD54+ cells represents gastric
            cancer CSCs, in which LGR5 is closely associated with stemness and
            EMT core genes
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1886)
  AUTHORS   Kawamura N, Nimura K, Nagano H, Yamaguchi S, Nonomura N and Kaneda
            Y.
  TITLE     CRISPR/Cas9-mediated gene knockout of NANOG and NANOGP8 decreases
            the malignant potential of prostate cancer cells
  JOURNAL   Oncotarget 6 (26), 22361-22374 (2015)
   PUBMED   26087476
  REMARK    GeneRIF: Results indicate that NANOG and NANOGP8 proteins are
            expressed in prostate cancer cell lines, and NANOG and NANOGP8
            equally contribute to the high malignant potential of prostate
            cancer.
REFERENCE   5  (bases 1 to 1886)
  AUTHORS   Liu Y, Wang C and Jiang Z.
  TITLE     [The expression of retrogene Nanogp8 is related to the biological
            characteristics of human SGC-7901 gastric cancer cells]
  JOURNAL   Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi 31 (6), 763-768 (2015)
   PUBMED   26062418
  REMARK    GeneRIF: NANOGP8 has a close relationship with the proliferation,
            cycle, apoptosis, migration and invasion of SGC-7901 gastric cancer
            cells
REFERENCE   6  (bases 1 to 1886)
  AUTHORS   Zbinden M, Duquet A, Lorente-Trigos A, Ngwabyt SN, Borges I and
            Ruiz i Altaba A.
  TITLE     NANOG regulates glioma stem cells and is essential in vivo acting
            in a cross-functional network with GLI1 and p53
  JOURNAL   EMBO J. 29 (15), 2659-2674 (2010)
   PUBMED   20581802
  REMARK    GeneRIF: NANOGP8 is expressed in primary human glioblastoma and is
            required for glioblastoma growth in xenograft assay in mice
REFERENCE   7  (bases 1 to 1886)
  AUTHORS   Jeter CR, Badeaux M, Choy G, Chandra D, Patrawala L, Liu C,
            Calhoun-Davis T, Zaehres H, Daley GQ and Tang DG.
  TITLE     Functional evidence that the self-renewal gene NANOG regulates
            human tumor development
  JOURNAL   Stem Cells 27 (5), 993-1005 (2009)
   PUBMED   19415763
REFERENCE   8  (bases 1 to 1886)
  AUTHORS   Zhang J, Wang X, Li M, Han J, Chen B, Wang B and Dai J.
  TITLE     NANOGP8 is a retrogene expressed in cancers
  JOURNAL   FEBS J. 273 (8), 1723-1730 (2006)
   PUBMED   16623708
REFERENCE   9  (bases 1 to 1886)
  AUTHORS   Booth HA and Holland PW.
  TITLE     Eleven daughters of NANOG
  JOURNAL   Genomics 84 (2), 229-238 (2004)
   PUBMED   15233988
REFERENCE   10 (bases 1 to 1886)
  AUTHORS   Hart AH, Hartley L, Ibrahim M and Robb L.
  TITLE     Identification, cloning and expression analysis of the pluripotency
            promoting Nanog genes in mouse and human
  JOURNAL   Dev. Dyn. 230 (1), 187-198 (2004)
   PUBMED   15108323
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC021231.8.
            On Dec 2, 2019 this sequence version replaced NM_001355281.1.
            
            Summary: This gene represents a transcribed retrogene of the Nanog
            homeobox gene. The putative encoded protein may participate in
            reprogramming of cancer cells. In vitro studies using a recombinant
            protein have shown that the protein localizes to the nucleus and
            can promote cell proliferation, similar to the Nanog protein.
            [provided by RefSeq, Sep 2017].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: BC069807.1 [ECO:0000345]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            MANE Ensembl match     :: ENST00000528386.4/ ENSP00000487073.2
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1886              AC021231.8         84715-86600         c
FEATURES             Location/Qualifiers
     source          1..1886
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q14"
     gene            1..1886
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="Nanog homeobox retrogene P8"
                     /db_xref="GeneID:388112"
                     /db_xref="HGNC:HGNC:23106"
     exon            1..1886
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1420070717"
     variation       6
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1318723085"
     variation       8
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1376800449"
     variation       20
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:560790910"
     variation       33
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:923810689"
     variation       34
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377726617"
     variation       42
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173728300"
     variation       43
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:868156824"
     variation       50
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1249930765"
     variation       57
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472430657"
     variation       59
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1178151938"
     variation       60
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1435076891"
     variation       61
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1173299963"
     misc_feature    66..68
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="upstream in-frame stop codon"
     variation       69
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1394002330"
     variation       71
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1426195600"
     variation       72..75
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1314284126"
     variation       78
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1368333042"
     variation       82
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1595400857"
     variation       91
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1192996486"
     variation       95..99
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="ctcta"
                     /db_xref="dbSNP:1298606205"
     variation       102
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1487387120"
     variation       107
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1595400848"
     variation       109
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302612457"
     variation       111
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112947139"
     variation       119
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1236593366"
     variation       131
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:574497397"
     variation       133..134
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1006529665"
     variation       135..140
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="tttttt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:953674603"
     variation       140
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1595400838"
     variation       146
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556188242"
     variation       151
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1487777221"
     variation       158..163
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="tttttt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:375087675"
     variation       168
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1193502487"
     variation       173
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1555382763"
     variation       180
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1254207567"
     variation       183
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201173873"
     CDS             186..1103
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="putative homeobox protein NANOGP8"
                     /codon_start=1
                     /product="homeobox protein NANOGP8"
                     /protein_id="NP_001342210.1"
                     /db_xref="CCDS:CCDS86444.1"
                     /db_xref="GeneID:388112"
                     /db_xref="HGNC:HGNC:23106"
                     /translation="
MSVDPACPQSLPCFEESDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMHFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV"
     misc_feature    468..638
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(474..485,489..491,540..542,558..560,597..599,
                     603..608,615..620,624..632,636..641)
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(477..479,486..488,606..608,615..620,627..629)
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    771..905
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NSW7.2);
                     Region: 8 X repeats starting with a Trp in each unit"
     misc_feature    771..905
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NSW7.2);
                     Region: Sufficient for transactivation activity.
                     /evidence=ECO:0000250"
     misc_feature    906..1100
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NSW7.2);
                     Region: Sufficient for strong transactivation activity.
                     /evidence=ECO:0000250"
     variation       188
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576842486"
     variation       190
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1387935359"
     variation       202
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:902088037"
     variation       214
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313568228"
     variation       218
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:558751591"
     variation       220
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1036960088"
     variation       232
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2004079"
     variation       236
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:533764849"
     variation       237
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1049137082"
     variation       241
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:566301093"
     variation       245
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:895183342"
     variation       258
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1056467494"
     variation       259
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:553972039"
     variation       269
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275408211"
     variation       273
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:939289648"
     variation       283..286
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="aaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:923868218"
     variation       288
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254164531"
     variation       297
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1470274908"
     variation       307
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194930253"
     variation       321..322
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1474809329"
     variation       322
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:978342408"
     variation       328
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:946529057"
     variation       330
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1467424550"
     variation       333
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1403332445"
     variation       342
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1359959910"
     variation       343
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1164024268"
     variation       350
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1170308251"
     variation       352
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1455034400"
     variation       353
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548081132"
     variation       356
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1462985016"
     variation       367
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1555382741"
     variation       373
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1425782340"
     variation       375
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2257251"
     variation       384
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1325877783"
     variation       388
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146363687"
     variation       389
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:953786580"
     variation       394
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1254747453"
     variation       399..401
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1029781311"
     variation       399
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:536101592"
     variation       402
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1202514011"
     variation       403
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:568154665"
     variation       405
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:976423880"
     variation       406
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:549901395"
     variation       409
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:966721543"
     variation       413
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1284219066"
     variation       414
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1445851033"
     variation       431
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:28366671"
     variation       432
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="aaaaaaaa"
                     /db_xref="dbSNP:1197558837"
     variation       433..439
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="gtgtcgc"
                     /db_xref="dbSNP:1279482458"
     variation       438
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1015155313"
     variation       440..445
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /db_xref="dbSNP:1243475252"
     variation       440
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1005058322"
     variation       448
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474059783"
     variation       450
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:531859023"
     variation       455
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186918425"
     variation       460
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227577556"
     variation       461
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4286068"
     variation       476
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:887912640"
     variation       490
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027817516"
     variation       497
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:564406958"
     variation       502
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1310564085"
     variation       504
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1320451527"
     variation       505
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012377776"
     variation       521
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866369406"
     variation       527
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1294162293"
     variation       540
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056897278"
     variation       541
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1279426879"
     variation       542
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397547181"
     variation       543
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1379551619"
     variation       547
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:939337658"
     variation       548
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4257165"
     variation       552
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:902446719"
     variation       559..581
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="tgcaagaactctccaacatcctg"
                     /replace="tgcaagaactctccaacatcctgcaagaactctccaacatcctg"
                     /db_xref="dbSNP:1257820207"
     variation       568
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1402759619"
     variation       590
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1566819772"
     variation       602
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1486490313"
     variation       606
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:552615594"
     variation       608
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201660508"
     variation       609
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1160352721"
     variation       614
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774382256"
     variation       622
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1434219229"
     variation       629
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457506586"
     variation       641
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1367232377"
     variation       652
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1190292700"
     variation       662
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946560032"
     variation       664
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:139005963"
     variation       668
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1336839117"
     variation       670
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1237888124"
     variation       683
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:985255828"
     variation       685..689
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="ag"
                     /replace="agaag"
                     /db_xref="dbSNP:1259633103"
     variation       685
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:369801105"
     variation       689
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1456152539"
     variation       690
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1232931386"
     variation       691
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:932423985"
     variation       698
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1595400677"
     variation       702
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1595400675"
     variation       706
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1037085824"
     variation       709
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:560631713"
     variation       713
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:542587940"
     variation       726
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1349669086"
     variation       728
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1193831172"
     variation       734
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1249620352"
     variation       735
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:922361001"
     variation       737
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2279066"
     variation       746
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1251069061"
     variation       750
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1355107488"
     variation       751
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:961034765"
     variation       752
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1174404782"
     variation       754
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397115936"
     variation       760
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1595400653"
     variation       762
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460694898"
     variation       768
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1015600710"
     variation       771..815
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="tggagcaaccagacc"
                     /replace="tggagcaaccagacctggaacaattcaacctggagcaaccagacc"
                     /db_xref="dbSNP:1595400632"
     variation       788
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983739995"
     variation       789
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1393530843"
     variation       791
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:952272650"
     variation       798
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562496082"
     variation       800
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1439499449"
     variation       801
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400641"
     variation       803..805
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="gag"
                     /db_xref="dbSNP:1303562396"
     variation       806
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027850036"
     variation       808
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1595400638"
     variation       813
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1595400637"
     variation       814
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9944179"
     variation       816
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1339753221"
     variation       820
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1595400626"
     variation       828..849
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="tcctgga"
                     /replace="tcctggagcaaccactcctgga"
                     /db_xref="dbSNP:1197354358"
     variation       831
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400624"
     variation       835
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576739974"
     variation       840
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1379358996"
     variation       843
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1595400617"
     variation       854
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1329874604"
     variation       866
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1271180577"
     variation       880
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1468031481"
     variation       883
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:558389694"
     variation       886
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540275117"
     variation       896
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1595400604"
     variation       907
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:572709530"
     variation       917
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1035086551"
     variation       934
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1003955462"
     variation       937
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209866492"
     variation       939
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:111376132"
     variation       943
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1595400590"
     variation       944
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:4041291"
     variation       945
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200095419"
     variation       947..948
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1328550584"
     variation       948
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182098466"
     variation       952
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1595400580"
     variation       959
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202002237"
     variation       960
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1157194984"
     variation       963
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1282693143"
     variation       964
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1010815111"
     variation       970
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326719179"
     variation       971..988
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="cttgga"
                     /replace="cttggaggctgccttgga"
                     /db_xref="dbSNP:1450688798"
     variation       975
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1239600598"
     variation       979
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1291253804"
     variation       983
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4041290"
     variation       990
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1275006605"
     variation       997
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1264606854"
     variation       1003
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484895485"
     variation       1011
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55876617"
     variation       1014
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:568786550"
     variation       1018
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430584453"
     variation       1021
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1285272573"
     variation       1023
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1595400550"
     variation       1025
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:893704169"
     variation       1026
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:556553943"
     variation       1031
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1595400543"
     variation       1043
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:537865369"
     variation       1047
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1555382708"
     variation       1059
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1167650298"
     variation       1063
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1343964134"
     variation       1064..1065
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1595400537"
     variation       1071
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1450980277"
     variation       1072
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1287852302"
     variation       1084
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1385189006"
     variation       1088
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1401513767"
     variation       1090
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1310716203"
     variation       1092
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355662654"
     variation       1097
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1233678528"
     variation       1098..1102
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="gtg"
                     /replace="gtgtg"
                     /db_xref="dbSNP:200785214"
     variation       1098
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369927144"
     variation       1100
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238413831"
     variation       1107..1113
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="tga"
                     /replace="tgagtga"
                     /db_xref="dbSNP:1329600519"
     variation       1110
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2279067"
     variation       1122
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325579890"
     variation       1128
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1257089873"
     variation       1131
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:552402123"
     variation       1141
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1360441669"
     variation       1142
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190589725"
     variation       1143
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406418925"
     variation       1145
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1296947470"
     variation       1147
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:527780156"
     variation       1157
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400495"
     variation       1164
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1363820717"
     variation       1166
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1595400493"
     variation       1169
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1595400490"
     variation       1175
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1421017615"
     variation       1177
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1595400487"
     variation       1178
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4041289"
     variation       1182
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1595400482"
     variation       1199
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400481"
     variation       1207
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:567119524"
     variation       1208
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1172391892"
     variation       1213
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1477462723"
     variation       1216
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400474"
     variation       1240
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1049576482"
     variation       1247
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1375628237"
     variation       1248
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304436931"
     variation       1249
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1371049335"
     variation       1252
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1390794275"
     variation       1253
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400460"
     variation       1255
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1307659911"
     variation       1259
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1595400459"
     variation       1260
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1355866484"
     variation       1267
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400454"
     variation       1269
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1200333785"
     variation       1276
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1595400450"
     variation       1277
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1348953933"
     variation       1278
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1490390195"
     variation       1279
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1262372700"
     variation       1280
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1214290685"
     variation       1282
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1489234167"
     variation       1285..1287
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="t"
                     /replace="tct"
                     /db_xref="dbSNP:1253292802"
     variation       1286
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:371084427"
     variation       1286
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:887585961"
     variation       1287..1303
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="ttttttttttt"
                     /replace="tttttttttttt"
                     /replace="ttttttttttttttt"
                     /replace="tttttttttttttttt"
                     /replace="ttttttttttttttttt"
                     /replace="tttttttttttttttttt"
                     /replace="ttttttttttttttttttt"
                     /db_xref="dbSNP:rs369549814"
     variation       1290
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1595400435"
     variation       1291
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548778317"
     variation       1295
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1413289915"
     variation       1301
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254363716"
     variation       1302
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1276894380"
     variation       1304..1305
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1379104746"
     variation       1304
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1298625933"
     variation       1305
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438797410"
     variation       1307
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1224183839"
     variation       1310
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1371976084"
     variation       1311
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221107323"
     variation       1312
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1339857264"
     variation       1313
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:932471070"
     variation       1314
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1048907875"
     variation       1318
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1402352885"
     variation       1321
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:530452204"
     variation       1322
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467574362"
     variation       1323
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1191167772"
     variation       1328
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1346328593"
     variation       1329
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1333897752"
     variation       1330
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1595400393"
     variation       1330
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1595400388"
     variation       1331..1350
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="ttttttttttttt"
                     /replace="ttttttttttttttt"
                     /replace="tttttttttttttttt"
                     /replace="ttttttttttttttttt"
                     /replace="tttttttttttttttttt"
                     /replace="ttttttttttttttttttt"
                     /replace="tttttttttttttttttttt"
                     /replace="ttttttttttttttttttttt"
                     /replace="ttttttttttttttttttttttttt"
                     /db_xref="dbSNP:rs71123114"
     variation       1332
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:111342805"
     variation       1333
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1399604097"
     variation       1334
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192505447"
     variation       1336
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1178218489"
     variation       1340
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1480567982"
     variation       1347..1351
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="ttttg"
                     /db_xref="dbSNP:1566819589"
     variation       1348..1351
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="tttg"
                     /db_xref="dbSNP:1361597384"
     variation       1349..1351
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="ttg"
                     /db_xref="dbSNP:1566819587"
     variation       1349
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1422207062"
     variation       1350..1351
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:1491149082"
     variation       1351..1354
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="ga"
                     /replace="gaga"
                     /db_xref="dbSNP:1242671136"
     variation       1351
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1280530726"
     variation       1352
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1333305674"
     variation       1353
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1478736569"
     variation       1354
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1595400352"
     variation       1355
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1451624120"
     variation       1356
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186566966"
     variation       1358
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1595400346"
     variation       1360
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400343"
     variation       1363
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1240002338"
     variation       1364
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1474901256"
     variation       1365
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194088540"
     variation       1371
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1440541392"
     variation       1372
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164048186"
     variation       1376
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1418501375"
     variation       1380
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400329"
     variation       1382
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1407141503"
     variation       1383
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1595400324"
     variation       1385
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400320"
     variation       1386
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1280486759"
     variation       1388
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344794457"
     variation       1393
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1431807038"
     variation       1394
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1204474012"
     variation       1395
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1317548975"
     variation       1396
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256182888"
     variation       1407
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1359162060"
     variation       1408
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1229507133"
     variation       1413
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1281585117"
     variation       1414
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1445940981"
     variation       1418
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220596044"
     variation       1419
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363235791"
     variation       1420
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113980102"
     variation       1423
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1566819567"
     variation       1423
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4041287"
     variation       1425
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:71464901"
     variation       1427
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1156867763"
     variation       1433
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337810644"
     variation       1434
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1420415578"
     variation       1435
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1160623299"
     variation       1437
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1595400281"
     variation       1447
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:868203532"
     variation       1448
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1414549894"
     variation       1457
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1313917999"
     variation       1458
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1399126097"
     variation       1461
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1440586160"
     variation       1464
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1279521822"
     variation       1468
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1349257305"
     variation       1477
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1167895354"
     variation       1478
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1411215308"
     variation       1479
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1345376514"
     variation       1480
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420120947"
     variation       1481
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1181150883"
     variation       1482
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867760782"
     variation       1485
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1179518188"
     variation       1487
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1244702339"
     variation       1488
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1183993550"
     variation       1490
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1440385086"
     variation       1493
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1180663919"
     variation       1494
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:865995338"
     variation       1497
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1236622885"
     variation       1501
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1308214615"
     variation       1501
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1200599047"
     variation       1502
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1434394311"
     variation       1508
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1289261374"
     variation       1513
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1404753940"
     variation       1516
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227040034"
     variation       1522
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:563056545"
     variation       1523..1526
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1446579003"
     variation       1523
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:62005128"
     variation       1525
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1271044564"
     variation       1533..1537
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="tgt"
                     /replace="tgtgt"
                     /db_xref="dbSNP:1328938747"
     variation       1533
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1375684122"
     variation       1540
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1443937089"
     variation       1544
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354546633"
     variation       1548
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1595400233"
     variation       1551
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310865442"
     variation       1554
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1163496174"
     variation       1557
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256255778"
     variation       1562
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1403487358"
     variation       1567
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1387064709"
     variation       1569
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1272201486"
     variation       1571
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1458193138"
     variation       1574
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163948300"
     variation       1576
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438927645"
     variation       1578
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1040767878"
     variation       1579
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:562624101"
     variation       1581
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1595400213"
     variation       1583
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1481086244"
     variation       1584
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246164713"
     variation       1588
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:532014249"
     variation       1592
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1219498081"
     variation       1595
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1391597721"
     variation       1595
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1453815214"
     variation       1596
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1293198500"
     variation       1601
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564856299"
     variation       1603
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1224931736"
     variation       1604..1606
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:199723559"
     variation       1604
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1269432856"
     variation       1607
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1271203159"
     variation       1608
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1468046339"
     variation       1609
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1210568821"
     variation       1612
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1351885425"
     variation       1613
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:539994148"
     variation       1615
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:572599242"
     variation       1619
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1479023272"
     variation       1622
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1225071455"
     variation       1623
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12914998"
     variation       1624
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:554368115"
     variation       1625
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1433726427"
     variation       1629
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:908242100"
     variation       1630
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297233781"
     variation       1633
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1340827071"
     variation       1637
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220252305"
     variation       1644
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1303748326"
     variation       1653
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1419035577"
     variation       1654
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291349826"
     variation       1658
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1321117219"
     variation       1661..1662
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="gc"
                     /replace="gctaaggacaacattgatagaagc"
                     /db_xref="dbSNP:1231869258"
     variation       1663
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542395871"
     variation       1664
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:952303501"
     variation       1671
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:575058597"
     variation       1674
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:531702312"
     variation       1676
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1419846556"
     variation       1677
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1186321086"
     variation       1694
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183121426"
     variation       1695
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1189522606"
     variation       1697
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167556567"
     variation       1706
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1369651492"
     variation       1711
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1481500536"
     variation       1714
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1451005153"
     variation       1718
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1157618363"
     variation       1721
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1269709270"
     variation       1722
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991004122"
     variation       1723
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1487610592"
     variation       1727
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1378315573"
     variation       1729
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538886855"
     variation       1731
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:959527259"
     variation       1740
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1314807821"
     variation       1742
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1035522858"
     variation       1746
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1217015552"
     variation       1747
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:570800695"
     variation       1748
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300245888"
     variation       1752
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201293583"
     variation       1755
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1280001223"
     variation       1757
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866610251"
     variation       1766
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1483802011"
     variation       1774
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1184043262"
     variation       1775
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249057130"
     variation       1777
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1416780728"
     variation       1780
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:967191831"
     variation       1785
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1346787241"
     variation       1790
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1380494719"
     variation       1791
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283371926"
     variation       1792
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020932708"
     variation       1794
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1010847644"
     variation       1796
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304457373"
     variation       1803
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1371166142"
     variation       1805..1810
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="tttttt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:1358576307"
     variation       1810
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1446121732"
     variation       1817..1819
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="t"
                     /replace="tat"
                     /db_xref="dbSNP:1379240960"
     variation       1818
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1310142331"
     variation       1824..1825
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="gt"
                     /replace="gtgt"
                     /db_xref="dbSNP:1290392522"
     variation       1830
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:893735473"
     variation       1832
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1595400087"
     variation       1836
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1454158676"
     variation       1859
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1358801697"
     variation       1860
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250127242"
     variation       1865
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457739621"
     variation       1866..1870
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="ttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1238198065"
     variation       1870
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1197430797"
     variation       1872
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1441032756"
     variation       1873
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1174146015"
ORIGIN      
gttctgctggactgagctggttgcctcatgttattatgcaggcaactcactttatcccaatttcttgatacttttccttctggaggtcctatttctctaacatcttccagaaaagtcttaaagctgccttaaccttttttccagtccacctcttaaattttttcctcctcttcctctatactaacatgagtgtggatccagcttgtccccaaagcttgccttgctttgaagaatccgactgtaaagaatcttcacctatgcctgtgatttgtgggcctgaagaaaactatccatccttgcaaatgtcttctgctgagatgcctcacacagagactgtctctcctcttccttcctccatggatctgcttattcaggacagccctgattcttccaccagtcccaaaggcaaacaacccacttctgcagagaatagtgtcgcaaaaaaggaagacaaggtcccggtcaagaaacagaagaccagaactgtgttctcttccacccagctgtgtgtactcaatgatagatttcagagacagaaatacctcagcctccagcagatgcaagaactctccaacatcctgaacctcagctacaaacaggtgaagacctggttccagaaccagagaatgaaatctaagaggtggcagaaaaacaactggccgaagaatagcaatggtgtgacgcagaaggcctcagcacctacctaccccagcctctactcttcctaccaccagggatgcctggtgaacccgactgggaaccttccaatgtggagcaaccagacctggaacaattcaacctggagcaaccagacccagaacatccagtcctggagcaaccactcctggaacactcagacctggtgcacccaatcctggaacaatcaggcctggaacagtcccttctataactgtggagaggaatctctgcagtcctgcatgcacttccagccaaattctcctgccagtgacttggaggctgccttggaagctgctggggaaggccttaatgtaatacagcagaccactaggtattttagtactccacaaaccatggatttattcctaaactactccatgaacatgcaacctgaagacgtgtgaagatgagtgaaactgatattactcaatttcagtctggacactggctgaatccttcctctcccctcctcccatccttcataggatttttcttgtttggaaaccacgtgttctggtttccatgatgcccatccagtcaatctcatggagggtggagtatggttggagcctaatcagcgaggtttctttttttttttttttttcctattggatcttcctggagaaaatacttttttttttttttttttttgagacggagtcttgctctgtcgcccaggctggagtgcagtggcgcggtcttggctcactgcaagctccgtctgccgggttcacgccattctcctgcctcagcctcccgagcagctgggactacaggcgcccgccacctcgcccggctaatattttgtatttttagtagagacggggtttcactgtgttagccaggatggtctcgatctcctgaccttgtgatccgcccgcctcggcctccctaacagctgggatttacaggcgtgagccaccgcgccctgcctagaaaagacattttaataaccttggctgccgtctctggctatagataagtagatctaatacgagtttggatatctttagggtttagaatctaacctcaagaataagaaatacaagtacaaattggtgatgaagatgtattcgtattgtttgggattgggaggctttgcttattttttaaaaactattgaggtaaagggttaagctgtaacatacttaattgatttcttaccgtttttggctctgttttgctat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]