GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 23:22:28, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001355281            1886 bp    mRNA    linear   PRI 20-DEC-2019
DEFINITION  Homo sapiens Nanog homeobox retrogene P8 (NANOGP8), mRNA.
ACCESSION   NM_001355281
VERSION     NM_001355281.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1886)
  AUTHORS   Ma X, Wang B, Wang X, Luo Y and Fan W.
  TITLE     NANOGP8 is the key regulator of stemness, EMT, Wnt pathway,
            chemoresistance, and other malignant phenotypes in gastric cancer
            cells
  JOURNAL   PLoS ONE 13 (4), e0192436 (2018)
   PUBMED   29689047
  REMARK    GeneRIF: NANOGP8 is the main regulator of gastric cancer stem
            cells. NANOGP8 is correlated with cell proliferation, migration,
            invasion, clonogenic capacity, beta-catenin accumulation in
            nucleus, and chemoresistance in gastric cancer.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1886)
  AUTHORS   Wang R, Bhattacharya R, Ye X, Fan F, Boulbes DR, Xia L and Ellis
            LM.
  TITLE     Endothelial cells activate the cancer stem cell-associated NANOGP8
            pathway in colorectal cancer cells in a paracrine fashion
  JOURNAL   Mol Oncol 11 (8), 1023-1034 (2017)
   PUBMED   28453235
  REMARK    GeneRIF: studies demonstrated a paracrine role for endothelial
            cells in regulating the cancer stem cells phenotype and
            chemoresistance in colorectal cancer cells by AKT-mediated
            induction of NANOGP8.
REFERENCE   3  (bases 1 to 1886)
  AUTHORS   Wang B, Chen Q, Cao Y, Ma X, Yin C, Jia Y, Zang A and Fan W.
  TITLE     LGR5 Is a Gastric Cancer Stem Cell Marker Associated with Stemness
            and the EMT Signature Genes NANOG, NANOGP8, PRRX1, TWIST1, and BMI1
  JOURNAL   PLoS ONE 11 (12), e0168904 (2016)
   PUBMED   28033430
  REMARK    GeneRIF: LGR5-expressing fraction of CD54+ cells represents gastric
            cancer CSCs, in which LGR5 is closely associated with stemness and
            EMT core genes
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1886)
  AUTHORS   Kawamura N, Nimura K, Nagano H, Yamaguchi S, Nonomura N and Kaneda
            Y.
  TITLE     CRISPR/Cas9-mediated gene knockout of NANOG and NANOGP8 decreases
            the malignant potential of prostate cancer cells
  JOURNAL   Oncotarget 6 (26), 22361-22374 (2015)
   PUBMED   26087476
  REMARK    GeneRIF: Results indicate that NANOG and NANOGP8 proteins are
            expressed in prostate cancer cell lines, and NANOG and NANOGP8
            equally contribute to the high malignant potential of prostate
            cancer.
REFERENCE   5  (bases 1 to 1886)
  AUTHORS   Liu Y, Wang C and Jiang Z.
  TITLE     [The expression of retrogene Nanogp8 is related to the biological
            characteristics of human SGC-7901 gastric cancer cells]
  JOURNAL   Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi 31 (6), 763-768 (2015)
   PUBMED   26062418
  REMARK    GeneRIF: NANOGP8 has a close relationship with the proliferation,
            cycle, apoptosis, migration and invasion of SGC-7901 gastric cancer
            cells
REFERENCE   6  (bases 1 to 1886)
  AUTHORS   Zbinden M, Duquet A, Lorente-Trigos A, Ngwabyt SN, Borges I and
            Ruiz i Altaba A.
  TITLE     NANOG regulates glioma stem cells and is essential in vivo acting
            in a cross-functional network with GLI1 and p53
  JOURNAL   EMBO J. 29 (15), 2659-2674 (2010)
   PUBMED   20581802
  REMARK    GeneRIF: NANOGP8 is expressed in primary human glioblastoma and is
            required for glioblastoma growth in xenograft assay in mice
REFERENCE   7  (bases 1 to 1886)
  AUTHORS   Jeter CR, Badeaux M, Choy G, Chandra D, Patrawala L, Liu C,
            Calhoun-Davis T, Zaehres H, Daley GQ and Tang DG.
  TITLE     Functional evidence that the self-renewal gene NANOG regulates
            human tumor development
  JOURNAL   Stem Cells 27 (5), 993-1005 (2009)
   PUBMED   19415763
REFERENCE   8  (bases 1 to 1886)
  AUTHORS   Zhang J, Wang X, Li M, Han J, Chen B, Wang B and Dai J.
  TITLE     NANOGP8 is a retrogene expressed in cancers
  JOURNAL   FEBS J. 273 (8), 1723-1730 (2006)
   PUBMED   16623708
REFERENCE   9  (bases 1 to 1886)
  AUTHORS   Booth HA and Holland PW.
  TITLE     Eleven daughters of NANOG
  JOURNAL   Genomics 84 (2), 229-238 (2004)
   PUBMED   15233988
REFERENCE   10 (bases 1 to 1886)
  AUTHORS   Hart AH, Hartley L, Ibrahim M and Robb L.
  TITLE     Identification, cloning and expression analysis of the pluripotency
            promoting Nanog genes in mouse and human
  JOURNAL   Dev. Dyn. 230 (1), 187-198 (2004)
   PUBMED   15108323
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC021231.8.
            On Dec 2, 2019 this sequence version replaced NM_001355281.1.
            
            Summary: This gene represents a transcribed retrogene of the Nanog
            homeobox gene. The putative encoded protein may participate in
            reprogramming of cancer cells. In vitro studies using a recombinant
            protein have shown that the protein localizes to the nucleus and
            can promote cell proliferation, similar to the Nanog protein.
            [provided by RefSeq, Sep 2017].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: BC069807.1 [ECO:0000345]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1886              AC021231.8         84715-86600         c
FEATURES             Location/Qualifiers
     source          1..1886
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q14"
     gene            1..1886
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="Nanog homeobox retrogene P8"
                     /db_xref="GeneID:388112"
                     /db_xref="HGNC:HGNC:23106"
     exon            1..1886
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    66..68
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="upstream in-frame stop codon"
     CDS             186..1103
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="putative homeobox protein NANOGP8"
                     /codon_start=1
                     /product="homeobox protein NANOGP8"
                     /protein_id="NP_001342210.1"
                     /db_xref="CCDS:CCDS86444.1"
                     /db_xref="GeneID:388112"
                     /db_xref="HGNC:HGNC:23106"
                     /translation="
MSVDPACPQSLPCFEESDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMHFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV"
     misc_feature    468..638
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(474..485,489..491,540..542,558..560,597..599,
                     603..608,615..620,624..632,636..641)
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(477..479,486..488,606..608,615..620,627..629)
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    771..905
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NSW7.2);
                     Region: 8 X repeats starting with a Trp in each unit"
     misc_feature    771..905
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NSW7.2);
                     Region: Sufficient for transactivation activity.
                     {ECO:0000250}"
     misc_feature    906..1100
                     /gene="NANOGP8"
                     /gene_synonym="NANOGP1; PN8"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6NSW7.2);
                     Region: Sufficient for strong transactivation activity.
                     {ECO:0000250}"
ORIGIN      
gttctgctggactgagctggttgcctcatgttattatgcaggcaactcactttatcccaatttcttgatacttttccttctggaggtcctatttctctaacatcttccagaaaagtcttaaagctgccttaaccttttttccagtccacctcttaaattttttcctcctcttcctctatactaacatgagtgtggatccagcttgtccccaaagcttgccttgctttgaagaatccgactgtaaagaatcttcacctatgcctgtgatttgtgggcctgaagaaaactatccatccttgcaaatgtcttctgctgagatgcctcacacagagactgtctctcctcttccttcctccatggatctgcttattcaggacagccctgattcttccaccagtcccaaaggcaaacaacccacttctgcagagaatagtgtcgcaaaaaaggaagacaaggtcccggtcaagaaacagaagaccagaactgtgttctcttccacccagctgtgtgtactcaatgatagatttcagagacagaaatacctcagcctccagcagatgcaagaactctccaacatcctgaacctcagctacaaacaggtgaagacctggttccagaaccagagaatgaaatctaagaggtggcagaaaaacaactggccgaagaatagcaatggtgtgacgcagaaggcctcagcacctacctaccccagcctctactcttcctaccaccagggatgcctggtgaacccgactgggaaccttccaatgtggagcaaccagacctggaacaattcaacctggagcaaccagacccagaacatccagtcctggagcaaccactcctggaacactcagacctggtgcacccaatcctggaacaatcaggcctggaacagtcccttctataactgtggagaggaatctctgcagtcctgcatgcacttccagccaaattctcctgccagtgacttggaggctgccttggaagctgctggggaaggccttaatgtaatacagcagaccactaggtattttagtactccacaaaccatggatttattcctaaactactccatgaacatgcaacctgaagacgtgtgaagatgagtgaaactgatattactcaatttcagtctggacactggctgaatccttcctctcccctcctcccatccttcataggatttttcttgtttggaaaccacgtgttctggtttccatgatgcccatccagtcaatctcatggagggtggagtatggttggagcctaatcagcgaggtttctttttttttttttttttcctattggatcttcctggagaaaatacttttttttttttttttttttgagacggagtcttgctctgtcgcccaggctggagtgcagtggcgcggtcttggctcactgcaagctccgtctgccgggttcacgccattctcctgcctcagcctcccgagcagctgggactacaggcgcccgccacctcgcccggctaatattttgtatttttagtagagacggggtttcactgtgttagccaggatggtctcgatctcctgaccttgtgatccgcccgcctcggcctccctaacagctgggatttacaggcgtgagccaccgcgccctgcctagaaaagacattttaataaccttggctgccgtctctggctatagataagtagatctaatacgagtttggatatctttagggtttagaatctaacctcaagaataagaaatacaagtacaaattggtgatgaagatgtattcgtattgtttgggattgggaggctttgcttattttttaaaaactattgaggtaaagggttaagctgtaacatacttaattgatttcttaccgtttttggctctgttttgctat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]