GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 01:05:57, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001353130            6474 bp    mRNA    linear   PRI 06-SEP-2020
DEFINITION  Homo sapiens PBX homeobox 1 (PBX1), transcript variant 4, mRNA.
ACCESSION   NM_001353130
VERSION     NM_001353130.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 6474)
  AUTHORS   Luck K, Kim DK, Lambourne L, Spirohn K, Begg BE, Bian W, Brignall
            R, Cafarelli T, Campos-Laborie FJ, Charloteaux B, Choi D, Cote AG,
            Daley M, Deimling S, Desbuleux A, Dricot A, Gebbia M, Hardy MF,
            Kishore N, Knapp JJ, Kovacs IA, Lemmens I, Mee MW, Mellor JC,
            Pollis C, Pons C, Richardson AD, Schlabach S, Teeking B, Yadav A,
            Babor M, Balcha D, Basha O, Bowman-Colin C, Chin SF, Choi SG,
            Colabella C, Coppin G, D'Amata C, De Ridder D, De Rouck S,
            Duran-Frigola M, Ennajdaoui H, Goebels F, Goehring L, Gopal A,
            Haddad G, Hatchi E, Helmy M, Jacob Y, Kassa Y, Landini S, Li R, van
            Lieshout N, MacWilliams A, Markey D, Paulson JN, Rangarajan S,
            Rasla J, Rayhan A, Rolland T, San-Miguel A, Shen Y, Sheykhkarimli
            D, Sheynkman GM, Simonovsky E, Tasan M, Tejeda A, Tropepe V,
            Twizere JC, Wang Y, Weatheritt RJ, Weile J, Xia Y, Yang X,
            Yeger-Lotem E, Zhong Q, Aloy P, Bader GD, De Las Rivas J, Gaudet S,
            Hao T, Rak J, Tavernier J, Hill DE, Vidal M, Roth FP and Calderwood
            MA.
  TITLE     A reference map of the human binary protein interactome
  JOURNAL   Nature 580 (7803), 402-408 (2020)
   PUBMED   32296183
REFERENCE   2  (bases 1 to 6474)
  AUTHORS   Ji D, Zhang P, Ma W, Fei Y, Xue W, Wang Y, Zhang X, Zhou H and Zhao
            Y.
  TITLE     Oncogenic heterogeneous nuclear ribonucleoprotein D-like modulates
            the growth and imatinib response of human chronic myeloid leukemia
            CD34(+) cells via pre-B-cell leukemia homeobox 1
  JOURNAL   Oncogene 39 (2), 443-453 (2020)
   PUBMED   31488872
  REMARK    GeneRIF: HNRPDL transforms hematopoietic cells and a novel
            HNRPDL/PBX1 axis plays an important role in human CML CD34(+) cells
REFERENCE   3  (bases 1 to 6474)
  AUTHORS   Liu F, Shi J, Zhang Y, Lian A, Han X, Zuo K, Liu M, Zheng T, Zou F,
            Liu X, Jin M, Mu Y, Li G, Su G and Liu J.
  TITLE     NANOG Attenuates Hair Follicle-Derived Mesenchymal Stem Cell
            Senescence by Upregulating PBX1 and Activating AKT Signaling
  JOURNAL   Oxid Med Cell Longev 2019, 4286213 (2019)
   PUBMED   31885790
  REMARK    GeneRIF: Findings show that NANOG delays HF-MSC senescence by
            upregulating PBX1 and activating AKT signaling and that a feedback
            loop likely exists between PBX1 and AKT signaling.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 6474)
  AUTHORS   Eudy AM, Voora D, Myers RA and Clowse MEB.
  TITLE     Effect of aspirin response signature gene expression on preterm
            birth and preeclampsia among women with lupus: a pilot study
  JOURNAL   Lupus 28 (14), 1640-1647 (2019)
   PUBMED   31684818
  REMARK    GeneRIF: Expression of PBX1 and MMD was higher in the second
            trimester among lupus patients who experienced a poor pregnancy
            outcome compared to those who did not.  The pilot study identified
            two candidate genes that are reflective of the platelet function
            response to aspirin.
REFERENCE   5  (bases 1 to 6474)
  AUTHORS   Jiang Y, Liu F, Zou F, Zhang Y, Wang B, Zhang Y, Lian A, Han X, Liu
            Z, Liu X, Jin M, Wang D, Li G and Liu J.
  TITLE     PBX homeobox 1 enhances hair follicle mesenchymal stem cell
            proliferation and reprogramming through activation of the
            AKT/glycogen synthase kinase signaling pathway and suppression of
            apoptosis
  JOURNAL   Stem Cell Res Ther 10 (1), 268 (2019)
   PUBMED   31443676
  REMARK    GeneRIF: PBX1 activated the NANOG promoter, upregulated NANOG
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 6474)
  AUTHORS   Lu Q, Wright DD and Kamps MP.
  TITLE     Fusion with E2A converts the Pbx1 homeodomain protein into a
            constitutive transcriptional activator in human leukemias carrying
            the t(1;19) translocation
  JOURNAL   Mol. Cell. Biol. 14 (6), 3938-3948 (1994)
   PUBMED   7910944
REFERENCE   7  (bases 1 to 6474)
  AUTHORS   Monica K, Galili N, Nourse J, Saltman D and Cleary ML.
  TITLE     PBX2 and PBX3, new homeobox genes with extensive homology to the
            human proto-oncogene PBX1
  JOURNAL   Mol. Cell. Biol. 11 (12), 6149-6157 (1991)
   PUBMED   1682799
REFERENCE   8  (bases 1 to 6474)
  AUTHORS   Hunger SP, Galili N, Carroll AJ, Crist WM, Link MP and Cleary ML.
  TITLE     The t(1;19)(q23;p13) results in consistent fusion of E2A and PBX1
            coding sequences in acute lymphoblastic leukemias
  JOURNAL   Blood 77 (4), 687-693 (1991)
   PUBMED   1671560
REFERENCE   9  (bases 1 to 6474)
  AUTHORS   Kamps MP, Murre C, Sun XH and Baltimore D.
  TITLE     A new homeobox gene contributes the DNA binding domain of the
            t(1;19) translocation protein in pre-B ALL
  JOURNAL   Cell 60 (4), 547-555 (1990)
   PUBMED   1967983
REFERENCE   10 (bases 1 to 6474)
  AUTHORS   Nourse J, Mellentin JD, Galili N, Wilkinson J, Stanbridge E, Smith
            SD and Cleary ML.
  TITLE     Chromosomal translocation t(1;19) results in synthesis of a
            homeobox fusion mRNA that codes for a potential chimeric
            transcription factor
  JOURNAL   Cell 60 (4), 535-545 (1990)
   PUBMED   1967982
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AK291415.1, BC143435.1,
            AL359255.12 and AL390119.25.
            
            Summary: This gene encodes a nuclear protein that belongs to the
            PBX homeobox family of transcriptional factors. Studies in mice
            suggest that this gene may be involved in the regulation of
            osteogenesis and required for skeletal patterning and programming.
            A chromosomal translocation, t(1;19) involving this gene and
            TCF3/E2A gene, is associated with pre-B-cell acute lymphoblastic
            leukemia. The resulting fusion protein, in which the DNA binding
            domain of E2A is replaced by the DNA binding domain of this
            protein, transforms cells by constitutively activating
            transcription of genes regulated by the PBX protein family.
            Alternatively spliced transcript variants encoding different
            isoforms have been found for this gene. [provided by RefSeq, Jun
            2017].
            
            Transcript Variant: This variant (4) lacks an exon in the 5' coding
            region and uses an alternate start codon, compared to variant 1.
            The encoded isoform (4) has a shorter and distinct N-terminus,
            compared to isoform 1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC143435.1 [ECO:0000332]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-49                AK291415.1         45-93
            50-209              BC143435.1         1-160
            210-210             AL359255.12        7907-7907
            211-1350            BC143435.1         162-1301
            1351-6474           AL390119.25        11749-16872
FEATURES             Location/Qualifiers
     source          1..6474
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1q23.3"
     gene            1..6474
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="PBX homeobox 1"
                     /db_xref="GeneID:5087"
                     /db_xref="HGNC:HGNC:8632"
                     /db_xref="MIM:176310"
     exon            1..292
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270664274"
     variation       10
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571217019"
     variation       17
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:895348857"
     variation       25..29
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1211533834"
     variation       38
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1325360427"
     variation       39
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1282124177"
     variation       42
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012363761"
     variation       47..59
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gagccgag"
                     /replace="gagccgagccgag"
                     /replace="gagccgagccgagccgag"
                     /db_xref="dbSNP:970787385"
     variation       49
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1446202470"
     variation       51
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755790509"
     variation       52
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:544814565"
     variation       56
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1421545656"
     variation       57
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1475407668"
     variation       58
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1240713863"
     variation       61..65
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ag"
                     /replace="agcag"
                     /db_xref="dbSNP:1311159937"
     variation       62
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354987293"
     variation       63
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1184121949"
     variation       65
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1415624530"
     variation       68
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1315175848"
     variation       70
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:558520686"
     variation       71
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238836294"
     variation       73
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1261788379"
     variation       78
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:921304480"
     variation       79..83
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ggggg"
                     /replace="gggggg"
                     /db_xref="dbSNP:1557859728"
     variation       80
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1364129043"
     variation       83
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1208024685"
     variation       89
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770433143"
     variation       90
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:931299581"
     variation       91
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1183221185"
     variation       93
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:187406949"
     variation       94
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1557859760"
     variation       95..97
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:779217453"
     variation       95
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1418254816"
     variation       99
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1182294962"
     variation       110
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375925928"
     variation       113
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1031011831"
     variation       119
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1344429665"
     variation       123
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:958254448"
     variation       131
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:940224282"
     variation       132
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435469620"
     variation       133
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:747490519"
     variation       139
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304780734"
     variation       145
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1431301757"
     variation       151
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769041303"
     variation       152
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1057295149"
     variation       153
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:544057798"
     variation       154
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379669919"
     variation       156
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765608918"
     variation       157
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:773577978"
     variation       158
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763090532"
     variation       159
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1211667432"
     variation       160
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1249217854"
     variation       161
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1480117986"
     variation       162
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2275558"
     variation       164
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1239772111"
     variation       165
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436664266"
     variation       172
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751494699"
     variation       177
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1418007558"
     variation       179
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372558581"
     variation       184
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1480951245"
     variation       188
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1044664177"
     variation       191
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1450777247"
     variation       192
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1192905716"
     variation       193
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:192264696"
     variation       196
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1433807647"
     variation       198
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1178355813"
     variation       200
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1000903065"
     variation       204
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1305643442"
     variation       205
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1461673861"
     variation       211
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1299022900"
     variation       212
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1402888460"
     variation       214
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370561885"
     variation       217
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1325785503"
     variation       227
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144593424"
     variation       235
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:777341799"
     variation       239
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292838914"
     variation       246
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571217834"
     misc_feature    253..255
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="upstream in-frame stop codon"
     variation       253
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111531180"
     variation       271
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306484700"
     variation       272
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:933098068"
     CDS             277..1320
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="isoform 4 is encoded by transcript variant 4;
                     pre-B-cell leukemia transcription factor 1; pre-B-cell
                     leukemia homeobox 1; homeobox protein PRL; homeobox
                     protein PBX1"
                     /codon_start=1
                     /product="pre-B-cell leukemia transcription factor 1
                     isoform 4"
                     /protein_id="NP_001340059.1"
                     /db_xref="GeneID:5087"
                     /db_xref="HGNC:HGNC:8632"
                     /db_xref="MIM:176310"
                     /translation="
MRRRPVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVMNLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQEEANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMSVQSLNGDSYQGAQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEGPGSVHSDTSN"
     misc_feature    <292..723
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="PBC domain; Region: PBC; pfam03792"
                     /db_xref="CDD:309062"
     misc_feature    727..909
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(727..741,745..747,805..807,823..825,862..864,
                     868..873,880..885,889..897,901..906)
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(733..735,742..744,871..873,880..885,892..894)
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     variation       279
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:866899815"
     variation       284
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1227689671"
     variation       287
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1281207783"
     variation       288
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148894677"
     exon            293..537
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       304
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1423937629"
     variation       305
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1481766438"
     variation       308
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35543782"
     variation       316
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867567117"
     variation       332
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1466947651"
     variation       342
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1162544117"
     variation       352
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757647151"
     variation       354
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032513241"
     variation       363
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:957073199"
     variation       369
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778963772"
     variation       375
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200580172"
     variation       379
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1332887753"
     variation       384
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772022038"
     variation       390
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147201088"
     variation       392
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775678833"
     variation       393
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1318898046"
     variation       396
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746943837"
     variation       397..398
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gg"
                     /replace="gggg"
                     /db_xref="dbSNP:1571416477"
     variation       403
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:962037824"
     variation       404..428
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cggcggcagcggcggc"
                     /replace="cggcggcagcggcggcagcggcggc"
                     /replace="cggcggcagcggcggcagcggcggcagcggcggc"
                     /db_xref="dbSNP:770921151"
     variation       404
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768635810"
     variation       405
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:912874716"
     variation       406..425
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gcggc"
                     /replace="gcggcagcggcggcagcggc"
                     /db_xref="dbSNP:1558010701"
     variation       406..416
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gcggcagcggc"
                     /replace="gcggcagcggcagcggc"
                     /db_xref="dbSNP:1558010693"
     variation       407
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1349939044"
     variation       408
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776560517"
     variation       410
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210943507"
     variation       414
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761524674"
     variation       415
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765108033"
     variation       416
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772720191"
     variation       417
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762709883"
     variation       419
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1571416623"
     variation       419
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765806321"
     variation       420
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751176674"
     variation       421..431
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gcggcggc"
                     /replace="gcggcggcggc"
                     /replace="gcggcggcggcggc"
                     /db_xref="dbSNP:774278800"
     variation       422
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185439958"
     variation       423
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541710796"
     variation       425
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458267934"
     variation       426
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558010796"
     variation       428
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754428947"
     variation       429
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199855181"
     variation       439..446
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="ggggcagg"
                     /db_xref="dbSNP:1553247020"
     variation       440
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1454591193"
     variation       442
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201279083"
     variation       445
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:953834516"
     variation       447
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746045110"
     variation       449
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:866426234"
     variation       454..455
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1553247028"
     variation       456
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758713117"
     variation       459
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780093664"
     variation       460
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571416832"
     variation       462
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340224297"
     variation       465
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246026174"
     variation       477
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1471356577"
     variation       478
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1286420275"
     variation       485
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747029494"
     variation       489
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558010879"
     variation       495
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215179946"
     variation       499
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1286107121"
     variation       504
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1489019776"
     variation       509
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1410575958"
     variation       525
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1208255806"
     variation       531
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143132748"
     variation       534
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1048843231"
     exon            538..728
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       540
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571430870"
     variation       546
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781292048"
     variation       561
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375506788"
     variation       567
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769833066"
     variation       574
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:953418388"
     variation       577
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1553248081"
     variation       585
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:556050975"
     variation       587
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1006016890"
     variation       591
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1329481193"
     variation       597
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749046771"
     variation       603
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:770880553"
     variation       606
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1411390288"
     variation       607
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774100520"
     variation       609
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759313222"
     variation       622
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771675680"
     variation       623
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1433896828"
     variation       629
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775205004"
     variation       644
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1421804755"
     variation       645
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1571431063"
     variation       645
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1465382616"
     variation       649
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571431073"
     variation       650
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1171842620"
     variation       678
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1402999260"
     variation       681
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41266608"
     variation       684
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765717583"
     variation       687
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763332823"
     variation       688
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571431145"
     variation       693
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1388049892"
     variation       695
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571431167"
     variation       703
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376272015"
     variation       707
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1553248110"
     variation       718
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1339461106"
     variation       725
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:868523852"
     variation       727
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1218945005"
     variation       728
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1553248112"
     exon            729..864
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       730
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571445295"
     variation       731
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1553249136"
     variation       732
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1353300228"
     variation       750
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768078814"
     variation       756
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773717794"
     variation       759
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190363555"
     variation       771
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766728137"
     variation       777
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283963117"
     variation       789
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488036135"
     variation       792
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751981086"
     variation       795
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1380228771"
     variation       804
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:897886845"
     variation       807..810
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1553249146"
     variation       816
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139881410"
     variation       828
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:982554794"
     variation       831
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1181661841"
     variation       837
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:767663970"
     variation       845
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558020021"
     exon            865..1024
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       873
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775760222"
     variation       889
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259895025"
     variation       897
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908352825"
     variation       900
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760848613"
     variation       902
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:866844940"
     variation       912
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1279657370"
     variation       924
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1314271113"
     variation       927
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764232094"
     variation       928
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753922245"
     variation       933
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384499111"
     variation       946
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1458613469"
     variation       955
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1181126074"
     variation       960
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148808502"
     variation       964
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558022479"
     variation       967
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477435698"
     variation       969
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1187713967"
     variation       971
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:546195075"
     variation       978
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757424601"
     variation       986
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:267598144"
     variation       997
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765200363"
     variation       1001
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558022514"
     variation       1002
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750417622"
     variation       1005
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558022534"
     variation       1010
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1400850042"
     variation       1011
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1388777814"
     variation       1013
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1290495014"
     variation       1020
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:755845426"
     exon            1025..1137
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       1025
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1175974386"
     variation       1029
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764163292"
     variation       1031
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1480599224"
     variation       1034
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1424046891"
     variation       1037
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:905922107"
     variation       1043
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1310898359"
     variation       1045
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256887115"
     variation       1049
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776997383"
     variation       1051
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161353651"
     variation       1056
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389953853"
     variation       1061
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1212721505"
     variation       1062
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1404783312"
     variation       1065
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1324292200"
     variation       1069
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1321918768"
     variation       1071
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761944828"
     variation       1074
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765425125"
     variation       1075
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750360584"
     variation       1077
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762835624"
     variation       1080
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:548599018"
     variation       1094
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1282894507"
     variation       1096
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751257842"
     variation       1098
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:561913596"
     variation       1108
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780672150"
     variation       1113
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1293305544"
     variation       1121..1122
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:34778614"
     variation       1121
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752373773"
     variation       1124
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1372566739"
     variation       1125
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186124927"
     variation       1126
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142396283"
     variation       1129
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:906379595"
     variation       1130
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746371607"
     variation       1131
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772515409"
     variation       1134
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:780621738"
     variation       1136
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747269460"
     exon            1138..1227
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       1144
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571471422"
     variation       1148
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1339209588"
     variation       1149
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759559064"
     variation       1150
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868781414"
     variation       1151
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201963901"
     variation       1159
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775324300"
     variation       1176
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:763668406"
     variation       1178
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753557796"
     variation       1181
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1037995461"
     variation       1187
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201029742"
     variation       1188
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188237782"
     variation       1191
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143289090"
     variation       1192
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541105414"
     variation       1194
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224719160"
     variation       1195
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564455203"
     variation       1196
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748459643"
     variation       1202
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1251320270"
     variation       1203
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420999764"
     variation       1205
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1196974442"
     variation       1208
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756581427"
     variation       1214
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466818722"
     variation       1215
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:533693615"
     variation       1217
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770885352"
     variation       1219
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146653553"
     variation       1225
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745780226"
     variation       1227
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1332683363"
     exon            1228..6474
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /inference="alignment:Splign:2.1.0"
     variation       1228..1229
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="tttttt"
                     /db_xref="dbSNP:1219033291"
     variation       1231
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1297562435"
     variation       1233
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568447228"
     variation       1238
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768408673"
     variation       1242
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1264921684"
     variation       1259
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:776551626"
     variation       1265
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558042645"
     variation       1267
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224964185"
     variation       1272
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:761357785"
     variation       1274..1277
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:34262468"
     variation       1275
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488141897"
     variation       1279
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773697815"
     variation       1281
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1309423234"
     variation       1286
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1205686195"
     variation       1290
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369700366"
     variation       1292
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150307059"
     variation       1300
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571521020"
     variation       1301
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302539075"
     variation       1312
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112169952"
     variation       1313
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1456864262"
     variation       1314
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1196037776"
     variation       1319
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1047727511"
     variation       1324
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762505114"
     variation       1325
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766036629"
     variation       1326
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:753224889"
     variation       1331
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377526450"
     variation       1332
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1295908467"
     variation       1333
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767477540"
     variation       1334
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377334192"
     variation       1339
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760736024"
     variation       1340
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370789005"
     variation       1341
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750663535"
     variation       1344
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142359401"
     variation       1348
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:894882134"
     variation       1349
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746944161"
     variation       1351
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1057073"
     variation       1352
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012379575"
     variation       1356
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1360211856"
     variation       1357
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1169530154"
     variation       1358
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:768695909"
     variation       1360
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765064083"
     variation       1364
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1353270743"
     variation       1366
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374816345"
     variation       1367
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1462998780"
     variation       1369
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769501548"
     variation       1370
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772900634"
     variation       1371
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:946028772"
     variation       1373
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1480312469"
     variation       1383
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1256723308"
     variation       1384
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571521353"
     variation       1389
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1041811833"
     variation       1393
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:553844911"
     variation       1395
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1310996728"
     variation       1396
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3205270"
     variation       1397
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:999209978"
     variation       1399
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558042889"
     variation       1400
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866068055"
     variation       1404
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1030870918"
     variation       1405
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:955333190"
     variation       1411
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1310907240"
     variation       1413
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:986578729"
     variation       1417
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:868513084"
     variation       1419
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571521449"
     variation       1420
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867804191"
     variation       1421
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1440357469"
     variation       1427
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1195461173"
     variation       1428
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1263591115"
     variation       1431
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753807663"
     variation       1436
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:963859438"
     variation       1439
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974541042"
     variation       1440
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1558042949"
     variation       1444
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1450095735"
     variation       1446
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755254056"
     variation       1450
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1172962696"
     variation       1451..1455
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ct"
                     /replace="cttct"
                     /db_xref="dbSNP:1420041931"
     variation       1453
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381946330"
     variation       1455
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:577619691"
     variation       1458
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:920029468"
     variation       1459
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:929958137"
     variation       1468
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256914404"
     variation       1475
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12135379"
     variation       1483
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184165420"
     variation       1488
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1257379146"
     variation       1492
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:961771639"
     variation       1493
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1402060327"
     variation       1494
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1299099536"
     variation       1511
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9771"
     variation       1515..1522
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttttttt"
                     /replace="tttttttt"
                     /replace="ttttttttt"
                     /db_xref="dbSNP:554904027"
     variation       1515
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:14832"
     variation       1521
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:928852710"
     variation       1522
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:938942127"
     variation       1534
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1056069445"
     variation       1536
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1229488023"
     variation       1537
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1398552957"
     variation       1539
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:532008899"
     variation       1547
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556891907"
     variation       1553
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1400554061"
     variation       1558
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867223594"
     variation       1565
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:947584541"
     variation       1566..1569
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1558043065"
     variation       1570
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332207308"
     variation       1571
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111327965"
     variation       1574
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:188518874"
     variation       1578
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1417263388"
     variation       1579
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195014886"
     variation       1582
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:548775179"
     variation       1588
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1261446317"
     variation       1588
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542038730"
     variation       1590
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1204969574"
     variation       1593
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1233277258"
     variation       1599
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:999597455"
     variation       1600
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250986103"
     variation       1604
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1246539569"
     variation       1605
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1331956630"
     variation       1608
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292201283"
     variation       1609
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375939144"
     variation       1610
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1052073693"
     variation       1611
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373586993"
     variation       1614
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1218336298"
     variation       1615
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1008070726"
     variation       1616
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1018167326"
     variation       1618
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:964183630"
     variation       1619
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995385778"
     variation       1625
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1487807102"
     variation       1639
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1027482280"
     variation       1650
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:527366247"
     variation       1659
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758063544"
     variation       1662
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1434059737"
     variation       1671
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1269932038"
     variation       1671
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:936101494"
     variation       1673
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541039475"
     variation       1675
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1466888729"
     variation       1678
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:780054564"
     variation       1679
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1271962740"
     variation       1688
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1198670922"
     regulatory      1694..1699
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="hexamer: AATAAA"
     variation       1696
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1050484368"
     variation       1702..1708
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tgt"
                     /replace="tgtttgt"
                     /db_xref="dbSNP:562096001"
     variation       1704
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:951519287"
     variation       1705
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1331456791"
     variation       1710
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040637726"
     variation       1711
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1375972626"
     variation       1716
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1421653911"
     polyA_site      1717
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="major polyA site"
     variation       1717
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:563699510"
     variation       1731
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:898033993"
     variation       1735
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1159411318"
     variation       1741
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1360134507"
     variation       1748
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:983172778"
     variation       1750
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:993197907"
     variation       1752
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752575028"
     variation       1753
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379729583"
     variation       1764
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571522183"
     variation       1766
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1197256219"
     variation       1769
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1454124002"
     variation       1776
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:533063454"
     variation       1782
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:549714267"
     variation       1785..1789
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ct"
                     /replace="cttct"
                     /db_xref="dbSNP:1386674131"
     variation       1785
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1247872756"
     variation       1788
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1195148602"
     variation       1789
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1453337752"
     variation       1797..1800
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tctt"
                     /replace="tcttctt"
                     /db_xref="dbSNP:1299902874"
     variation       1802
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1328835049"
     variation       1805
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1231746580"
     variation       1807
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1346927888"
     variation       1809
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310177319"
     variation       1810
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1449298393"
     variation       1816
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1334044991"
     variation       1822
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41266618"
     variation       1823
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1033380100"
     variation       1824
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558043309"
     variation       1832
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777912982"
     variation       1840
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1404915859"
     variation       1844
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:960533662"
     variation       1851
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1309450229"
     variation       1860
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1352573369"
     variation       1861
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867438784"
     variation       1867
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916175535"
     variation       1874
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1180535741"
     variation       1875..1879
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tc"
                     /replace="tcttc"
                     /db_xref="dbSNP:1442520970"
     variation       1875
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1258137631"
     variation       1876
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:947536189"
     variation       1880
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991912321"
     variation       1884
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:529120684"
     variation       1886..1889
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:35445188"
     variation       1888
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485189590"
     variation       1893
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286547625"
     variation       1906
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1242582450"
     variation       1910
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1348863204"
     variation       1913
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020886716"
     variation       1922
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925008063"
     variation       1929
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1245561558"
     variation       1935
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:548884046"
     variation       1939
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1209147195"
     variation       1947
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:568555769"
     variation       1951
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1441547544"
     variation       1963
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:890769206"
     variation       1972
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:925973025"
     variation       1979
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3738195"
     variation       1993
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1402060778"
     variation       2007
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1405288301"
     variation       2009
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1157670961"
     variation       2013
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115818637"
     variation       2014
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:570904135"
     variation       2016
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944859347"
     variation       2019
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040920915"
     variation       2025
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263593513"
     variation       2033
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218453832"
     variation       2034
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445097600"
     variation       2038
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039587704"
     variation       2040
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754588464"
     variation       2044
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1167222730"
     variation       2044
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:539830647"
     variation       2045
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929570688"
     variation       2047
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1291583374"
     variation       2050
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:995728529"
     variation       2051
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1049316364"
     variation       2056
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1280678226"
     variation       2069
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1429014614"
     variation       2082
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026848210"
     variation       2090
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571522749"
     variation       2093
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001788462"
     variation       2099
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558043518"
     variation       2101
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448303153"
     variation       2102
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1396031465"
     variation       2111
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1033390093"
     variation       2114
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558043527"
     variation       2120
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747856055"
     variation       2133
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6426881"
     variation       2137
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772957901"
     variation       2143
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474268783"
     variation       2145
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749671886"
     variation       2147
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1013431736"
     variation       2149
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1221689739"
     variation       2154..2155
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ta"
                     /replace="taaaata"
                     /db_xref="dbSNP:1271325952"
     variation       2156
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1021237702"
     variation       2162
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1035778123"
     variation       2166
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147638800"
     variation       2182
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1213339472"
     variation       2186
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1361681709"
     variation       2187
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1275884827"
     variation       2189
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1436716729"
     variation       2190
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372789435"
     variation       2191
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142283079"
     variation       2196
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368405625"
     variation       2200
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1460404391"
     variation       2206
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1400403828"
     variation       2224
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991523866"
     variation       2226
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172425755"
     variation       2229
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:916148850"
     variation       2240
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1172993609"
     variation       2259
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:969023069"
     variation       2260
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571523044"
     variation       2263..2270
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="acacac"
                     /replace="acacacac"
                     /db_xref="dbSNP:1491151856"
     variation       2264
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1491273073"
     variation       2264
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:986090968"
     variation       2266
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458224102"
     variation       2268
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1240166890"
     variation       2270
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263561545"
     variation       2271
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:979326659"
     variation       2272..2273
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:796099230"
     variation       2275
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1221247789"
     variation       2280
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:976173382"
     variation       2282
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:919457856"
     variation       2292
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1376983142"
     variation       2293
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:924775231"
     variation       2303
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:934843287"
     variation       2304
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459050694"
     variation       2307
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:987811573"
     variation       2314
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1199244377"
     variation       2318
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:912345250"
     variation       2319
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145716228"
     variation       2324
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1183803783"
     variation       2334
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1039367384"
     variation       2335
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:899734511"
     variation       2339
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1173234917"
     variation       2342
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1440621074"
     variation       2343
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1410217542"
     variation       2345
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1423536000"
     variation       2347
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184230234"
     variation       2358
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:931214301"
     variation       2361
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571523277"
     variation       2362
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1480363301"
     variation       2363
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:3185695"
     variation       2369
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886905745"
     variation       2375
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1213656170"
     variation       2376
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:563837840"
     variation       2384
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1280146312"
     variation       2394..2397
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1233070122"
     variation       2396
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1354031336"
     variation       2398
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774976931"
     variation       2406
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1426354109"
     variation       2408
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1035770173"
     variation       2413..2417
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aca"
                     /replace="acaca"
                     /db_xref="dbSNP:1466584111"
     variation       2417
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:895945449"
     variation       2420
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1303301200"
     variation       2424
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1416605442"
     variation       2428
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373389510"
     variation       2435
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937695219"
     variation       2450
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147776492"
     variation       2452
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1439406115"
     variation       2453
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1012905821"
     variation       2456
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304150355"
     variation       2459
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1157239613"
     variation       2461
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1418517659"
     variation       2465
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759956201"
     variation       2466
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:539466769"
     variation       2475
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896144719"
     variation       2478
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1013777866"
     variation       2482
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1157591136"
     variation       2486
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1291184390"
     variation       2488
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1487071775"
     variation       2499
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1262051750"
     variation       2512
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1213234014"
     variation       2514
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141192050"
     variation       2516
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042139634"
     variation       2521
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558043870"
     variation       2524
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:542999210"
     variation       2525
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1353543408"
     variation       2538
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1316082136"
     variation       2544
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1032343769"
     variation       2546
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386883656"
     variation       2563
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1287316540"
     variation       2572
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1453396214"
     variation       2573
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767675289"
     variation       2576
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775524622"
     variation       2578
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350505328"
     variation       2586
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167249833"
     variation       2589
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459961555"
     variation       2616
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571523657"
     variation       2632
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760694683"
     variation       2633
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1195039306"
     variation       2636
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:6683162"
     variation       2648
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1184401946"
     variation       2651
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1485363876"
     variation       2654
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1180391417"
     variation       2656
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:975145244"
     variation       2657..2660
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tgtt"
                     /replace="tgttgtt"
                     /db_xref="dbSNP:1273250804"
     variation       2661
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558043940"
     variation       2678
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181970491"
     variation       2679
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1007579477"
     variation       2686
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1170582364"
     variation       2690
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1272401889"
     variation       2696
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:143488511"
     variation       2699
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:920916158"
     variation       2711
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1017640639"
     variation       2715
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:966068436"
     variation       2718
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1381837178"
     variation       2720
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930974965"
     variation       2721
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79721421"
     variation       2728
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:919314962"
     variation       2729
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1393848447"
     variation       2730
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1171995624"
     variation       2732
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1464041294"
     variation       2738
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1407669931"
     variation       2753..2757
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ga"
                     /replace="gagga"
                     /db_xref="dbSNP:1371669183"
     variation       2754..2776
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="aggacctgagaatcatggggaaa"
                     /db_xref="dbSNP:781642115"
     variation       2757
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1177646131"
     variation       2760
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1434143919"
     variation       2760
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:528286032"
     variation       2761
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195117268"
     variation       2768
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1466737398"
     variation       2776
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:939834124"
     variation       2785
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196269960"
     variation       2787
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459101386"
     variation       2794
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375028098"
     variation       2820
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:909480204"
     variation       2834
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571523981"
     variation       2836
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751559967"
     variation       2857
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1277420235"
     variation       2863
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:938294188"
     variation       2868
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1439058903"
     variation       2869
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1370334468"
     variation       2877
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1055286998"
     variation       2879
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524050"
     variation       2889
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1393625136"
     variation       2890
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754853159"
     variation       2892
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298139881"
     variation       2893
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369440305"
     variation       2894
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397290507"
     variation       2908
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1023490847"
     variation       2911
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1311724845"
     variation       2919
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1128595"
     variation       2920
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175120316"
     variation       2925
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1208979749"
     variation       2927
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:539866852"
     variation       2940
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1288502448"
     variation       2947..2950
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="atca"
                     /replace="atcaatca"
                     /db_xref="dbSNP:1042542482"
     variation       2947
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1181837907"
     variation       2949
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1000614723"
     variation       2966
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868081472"
     variation       2970
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1031918658"
     variation       2971
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1001125741"
     variation       2974
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1488790981"
     variation       2976
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1128596"
     variation       2981
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1485868102"
     variation       2982
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1282288804"
     variation       2983
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781230082"
     variation       2990
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1394391502"
     variation       3012
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524237"
     variation       3013
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347492147"
     variation       3022
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:987584485"
     variation       3027
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1053589903"
     variation       3030
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1334066436"
     variation       3041
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:550169170"
     variation       3043
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1416003328"
     variation       3067
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006849755"
     variation       3070
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:964866998"
     variation       3074
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1019533707"
     variation       3078..3079
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="at"
                     /replace="atat"
                     /db_xref="dbSNP:1434508850"
     variation       3078
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:975150580"
     variation       3080
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1479273696"
     variation       3082
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1192337232"
     variation       3085
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1361618921"
     variation       3086
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:41266620"
     variation       3089
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568818969"
     variation       3090
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:537699693"
     variation       3093
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1362079400"
     variation       3094
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:950800311"
     variation       3099
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1207136710"
     variation       3100
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1348617477"
     variation       3106
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:908441792"
     variation       3113
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1016412100"
     regulatory      3116..3121
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="hexamer: AATAAA"
     variation       3122
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:554844532"
     variation       3123
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:991067355"
     variation       3124
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1057084331"
     variation       3127
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:918144489"
     variation       3129
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:949075197"
     variation       3134
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382103342"
     variation       3142
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:977762725"
     variation       3143
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148020619"
     regulatory      3144..3149
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="hexamer: AATAAA"
     variation       3145
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948539129"
     variation       3146
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1461530356"
     polyA_site      3149
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="major polyA site"
     variation       3149
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1044453930"
     variation       3151
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1275421805"
     variation       3152
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1242550224"
     variation       3153
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1366986699"
     variation       3158..3164
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttgt"
                     /replace="ttgttgt"
                     /db_xref="dbSNP:936463399"
     variation       3160
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1053529629"
     variation       3163
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779658878"
     polyA_site      3166
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="major polyA site"
     variation       3170
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1000180944"
     variation       3171
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889656845"
     variation       3173
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1053555891"
     variation       3175
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1340492498"
     variation       3182
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354731746"
     variation       3191
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1432431769"
     variation       3195
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1324272984"
     variation       3200
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:891808265"
     variation       3201
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1440922179"
     variation       3202
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777578170"
     variation       3205
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1162691711"
     variation       3212
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524678"
     variation       3214
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524685"
     variation       3215
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141517830"
     variation       3222
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:964815048"
     variation       3231..3237
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tctt"
                     /replace="tcttctt"
                     /db_xref="dbSNP:1222945161"
     variation       3232
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1419933764"
     variation       3233
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1169376714"
     variation       3241
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:996782115"
     variation       3249
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1246643997"
     variation       3254
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194517497"
     variation       3257
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886418939"
     variation       3261
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1006302434"
     variation       3262
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1251291557"
     variation       3266
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:572601779"
     variation       3287
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524796"
     variation       3292
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1191228942"
     variation       3301
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438949755"
     variation       3306
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:952595637"
     variation       3318
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748876013"
     variation       3325
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1213138788"
     variation       3327
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983791845"
     variation       3328
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:535214220"
     variation       3331
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1296348270"
     variation       3343
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:552480658"
     variation       3349
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1372538375"
     variation       3350
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771388964"
     variation       3354..3355
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:1323360002"
     variation       3373
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1435154012"
     variation       3377
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571524912"
     variation       3378
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405501788"
     variation       3379
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1406940144"
     variation       3383
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908180050"
     variation       3384
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779115305"
     variation       3385
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:961053337"
     variation       3389
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:992707468"
     variation       3390
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:970975547"
     variation       3392
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1324047415"
     variation       3399
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:917180595"
     variation       3403
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150459354"
     variation       3405
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1044642876"
     variation       3408
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1377809037"
     variation       3416
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:936313731"
     variation       3418
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:926044398"
     variation       3421
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1558044479"
     variation       3424
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:910933976"
     variation       3432
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:936053669"
     variation       3433
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1349535088"
     variation       3442
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:577297529"
     variation       3451
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:942528678"
     variation       3454
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1358831238"
     variation       3456
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373441366"
     variation       3465
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040868431"
     variation       3468
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1053147625"
     variation       3470
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1558044513"
     variation       3474
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772476783"
     variation       3478
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1369683493"
     variation       3481
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1289731312"
     variation       3490
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:900987508"
     variation       3495
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1467549020"
     variation       3499
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1175634294"
     variation       3502
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1008860688"
     variation       3504
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1410334290"
     variation       3505
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1047420999"
     variation       3516
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472576764"
     variation       3521
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571525186"
     variation       3525
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1258633471"
     variation       3526
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:775911091"
     variation       3528
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190461384"
     variation       3530
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886476861"
     variation       3537
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867140698"
     variation       3540
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1253823028"
     variation       3544..3548
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1209057805"
     variation       3546
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:748572904"
     variation       3548
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:900801582"
     variation       3553
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187013832"
     variation       3555
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1285794028"
     variation       3561
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1028267063"
     variation       3562
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:562902720"
     variation       3566
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571525305"
     variation       3567
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:952260344"
     variation       3579
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1349744611"
     variation       3583
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1005690253"
     variation       3592
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1015357293"
     variation       3598
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558044613"
     variation       3599
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1302473591"
     variation       3601
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1454563987"
     variation       3602
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1016305334"
     variation       3622
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571525374"
     variation       3624
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760758168"
     variation       3630
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1157078579"
     variation       3631
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1180637517"
     variation       3632
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1456804409"
     variation       3634
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280312662"
     variation       3635
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1419122766"
     variation       3644
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230820553"
     variation       3648
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474421509"
     variation       3652
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1473620966"
     variation       3657
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163661344"
     variation       3667
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412855344"
     variation       3668
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:992529735"
     variation       3670
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:573881035"
     variation       3672
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459791537"
     variation       3673
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1180889501"
     variation       3678
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:749578736"
     variation       3682
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1558044690"
     variation       3687
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1243510825"
     variation       3706
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1012385065"
     variation       3711
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1327870372"
     variation       3712
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:895988545"
     variation       3713
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1273674904"
     variation       3721..3723
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1235124302"
     variation       3724
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1010372536"
     variation       3728
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:190818629"
     variation       3730
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571525610"
     variation       3731
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768709724"
     variation       3732
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371564314"
     variation       3737
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1287334640"
     variation       3746
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1446138942"
     variation       3753
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:574586184"
     variation       3762
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:528307386"
     variation       3764
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:935849951"
     variation       3777
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:988822105"
     variation       3778
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138455027"
     variation       3781..3787
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="agaga"
                     /replace="agagaga"
                     /db_xref="dbSNP:1171505815"
     variation       3784
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:922498500"
     variation       3786
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:181559889"
     variation       3791
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1464040746"
     variation       3792
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944706412"
     variation       3794
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:185832619"
     variation       3799
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:550210083"
     variation       3807
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040375710"
     variation       3810
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1041811075"
     variation       3817
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227800875"
     variation       3820
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571525795"
     variation       3824
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1309049055"
     variation       3828
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571525812"
     variation       3836
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1295656208"
     variation       3838
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:929792632"
     variation       3841
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333207698"
     variation       3845
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558044817"
     variation       3858
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1371778004"
     variation       3861
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1328061248"
     variation       3865
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1220986344"
     variation       3867
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1390596814"
     variation       3878
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259340016"
     variation       3889
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1046982573"
     variation       3894
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:375873881"
     variation       3901
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111698027"
     variation       3902
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571525917"
     variation       3904
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1443761305"
     variation       3905
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448544906"
     variation       3907
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1187881361"
     variation       3908
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256527282"
     variation       3909
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1395142285"
     variation       3910
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190159894"
     variation       3911
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566347092"
     variation       3915
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1571525987"
     variation       3921
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:534916356"
     variation       3922
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1266510726"
     variation       3928..3929
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="gtg"
                     /db_xref="dbSNP:1196365547"
     variation       3929
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113819464"
     variation       3930..3931
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1272255448"
     variation       3934
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1244316108"
     variation       3946
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1445860121"
     variation       3947
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1156308653"
     variation       3950
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379224421"
     variation       3951
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1037639972"
     variation       3952
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1160895854"
     variation       3953
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1364386901"
     variation       3956
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308323876"
     variation       3957
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368896544"
     variation       3961
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1393718305"
     variation       3964
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571526114"
     variation       3969
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1357177381"
     variation       3975
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751335822"
     variation       3977
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:895139826"
     variation       3980
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762735499"
     variation       3985
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571526162"
     variation       3986
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1012311410"
     variation       3987..3996
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="ctcccccggc"
                     /db_xref="dbSNP:1454588987"
     variation       3989..4006
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cccccggca"
                     /replace="cccccggcacccccggca"
                     /db_xref="dbSNP:1558044952"
     variation       3989..3993
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:764135164"
     variation       3989
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1307177222"
     variation       3992
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1215873715"
     variation       3993
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:557904479"
     variation       3994
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770561375"
     variation       3998..4002
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1286661447"
     variation       3998
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774067714"
     variation       3999
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209871817"
     variation       4002
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1264226356"
     variation       4003
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:906708754"
     variation       4005
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1177375922"
     variation       4010
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1237007607"
     variation       4011
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1000060382"
     variation       4012
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:571027024"
     variation       4015
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1470231391"
     variation       4015
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759134405"
     variation       4020
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1422653975"
     variation       4021
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1468394184"
     variation       4023
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1218784334"
     variation       4024
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:536700162"
     variation       4027
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1241781488"
     variation       4029
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867919323"
     variation       4032
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:557014623"
     variation       4033
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1408115043"
     variation       4034
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571526441"
     variation       4042
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767564399"
     variation       4043
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:573595757"
     variation       4051
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1353980339"
     variation       4053
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:976562971"
     variation       4054
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:922311476"
     variation       4056
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1158588887"
     variation       4058
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1365761665"
     variation       4064
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764598049"
     variation       4065
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:982998161"
     variation       4069
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:182360910"
     variation       4070..4074
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ag"
                     /replace="aggag"
                     /db_xref="dbSNP:1185653754"
     variation       4070
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1326156659"
     variation       4074
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1262726652"
     variation       4081
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1197266182"
     variation       4089
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1327175055"
     variation       4092
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:941312781"
     variation       4093
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1571526587"
     variation       4104
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1234505212"
     variation       4107
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1218548873"
     variation       4110
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1263761504"
     variation       4112
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:553017437"
     variation       4116
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571526621"
     variation       4117
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190994237"
     variation       4126
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1379430697"
     variation       4137
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1339468836"
     variation       4144
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1318571203"
     variation       4146
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143084650"
     variation       4151
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1173173856"
     variation       4156
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:948014112"
     variation       4158
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1319804904"
     variation       4175
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1373878724"
     variation       4176
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1046476739"
     variation       4194
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1421850501"
     variation       4197
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161194178"
     variation       4198..4203
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="at"
                     /replace="atagat"
                     /db_xref="dbSNP:1472363439"
     variation       4199
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1373797966"
     variation       4200
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:545237076"
     variation       4201
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1299156227"
     variation       4202
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:12137588"
     variation       4204
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116759584"
     variation       4205
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304141065"
     variation       4210
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1214851924"
     variation       4212
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1053061851"
     variation       4213
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571526773"
     variation       4223
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1228069760"
     variation       4225
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543983297"
     variation       4226
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1011200783"
     variation       4229
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230209711"
     variation       4230
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302178029"
     variation       4231
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:576984876"
     variation       4232
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1241922143"
     variation       4238..4241
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1558045400"
     variation       4238
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1441018820"
     variation       4239
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1286443035"
     variation       4240
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1485453705"
     variation       4243
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1203308358"
     variation       4249
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571526868"
     variation       4250
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1018529680"
     variation       4260
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:563796122"
     variation       4261
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:866848365"
     variation       4265
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1393455314"
     variation       4270
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1194269226"
     variation       4273
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1197602716"
     variation       4274
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777413071"
     variation       4275
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377715625"
     variation       4280
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1441758417"
     variation       4290
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571526950"
     variation       4293
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:755364079"
     variation       4297
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1029432783"
     variation       4303
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1159544458"
     variation       4304
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571526972"
     variation       4307
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1571526999"
     variation       4309
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1339560681"
     variation       4314
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1213289"
     variation       4315
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1234327436"
     variation       4321
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:982542625"
     variation       4328
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1295744057"
     variation       4329
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1558045489"
     variation       4330
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571527085"
     variation       4332
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016749580"
     variation       4340
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185807689"
     variation       4341
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146049929"
     variation       4342
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:915788244"
     variation       4344
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1324600459"
     variation       4345
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140017132"
     variation       4353
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41266622"
     variation       4357
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1423202291"
     variation       4366
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1309616314"
     variation       4370
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1180661042"
     variation       4371
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1254609474"
     variation       4373
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:551569750"
     variation       4377
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1316044169"
     variation       4392
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:927972228"
     variation       4397
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:571554122"
     variation       4398
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571527214"
     variation       4399
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746247722"
     variation       4409
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537238536"
     variation       4414
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:556812877"
     variation       4421
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357001564"
     variation       4423
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273399073"
     variation       4435
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1211212188"
     variation       4438
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772366889"
     variation       4440
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:935437826"
     variation       4442
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1052518806"
     variation       4451
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:894012230"
     variation       4452..4460
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tctctct"
                     /replace="tctctctct"
                     /db_xref="dbSNP:1351230935"
     variation       4459..4468
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ct"
                     /replace="ctttcctgct"
                     /db_xref="dbSNP:200522109"
     variation       4460..4462
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1290173667"
     variation       4460
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:946834907"
     variation       4466
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1039982415"
     variation       4467
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:567330020"
     variation       4469
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:900060161"
     variation       4474
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1450542031"
     variation       4475
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1357487611"
     variation       4483
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1175377847"
     variation       4484
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:576814142"
     variation       4496
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:542206938"
     variation       4500
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997875225"
     variation       4501
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192322594"
     variation       4529
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250098825"
     variation       4530
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1157614454"
     variation       4537
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1571527455"
     variation       4538..4545
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaaa"
                     /replace="aaaaaaaaa"
                     /db_xref="dbSNP:1417654637"
     variation       4545
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1258699485"
     variation       4559..4565
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaa"
                     /replace="aaaaaaa"
                     /db_xref="dbSNP:1558045678"
     variation       4564
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780597576"
     variation       4566
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1483998359"
     variation       4567..4571
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="actca"
                     /db_xref="dbSNP:1235392861"
     variation       4570
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1369448550"
     variation       4573
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747512058"
     variation       4574
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866922454"
     variation       4581
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886761510"
     variation       4604
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1004411019"
     variation       4613
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1293741075"
     variation       4614
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768764647"
     variation       4615
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1431506039"
     variation       4625
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1298334512"
     variation       4626
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1319087628"
     variation       4635
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1419229968"
     variation       4640..4648
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tgatga"
                     /replace="tgatgatga"
                     /db_xref="dbSNP:1167269262"
     variation       4644
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372182793"
     variation       4655
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:183653789"
     variation       4661
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:991257001"
     variation       4673
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761907288"
     regulatory      4684..4689
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="hexamer: AAGAAA"
     variation       4686
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571527638"
     variation       4687..4696
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaaaa"
                     /replace="aaaaaaaaaa"
                     /replace="aaaaaaaaaaa"
                     /db_xref="dbSNP:540998480"
     variation       4692
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571527657"
     variation       4693
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571527666"
     variation       4697
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1355917665"
     variation       4699..4704
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1558045772"
     polyA_site      4704
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="major polyA site"
     variation       4704
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1232603706"
     variation       4705
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464341771"
     variation       4706
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265964788"
     variation       4707
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:981363270"
     variation       4718
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1319726161"
     variation       4719
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1320023910"
     variation       4722
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1367431878"
     variation       4728
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295425702"
     regulatory      4730..4735
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="hexamer: AATAAA"
     variation       4733..4737
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aa"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1199375870"
     variation       4735
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1395808691"
     variation       4742
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1250933959"
     polyA_site      4749
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
     variation       4755..4757
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="ata"
                     /db_xref="dbSNP:1479763227"
     variation       4758
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1183868164"
     variation       4761
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189051618"
     variation       4762
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:545278031"
     variation       4764
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:558889991"
     variation       4770..4771
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:927993386"
     variation       4772
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1186047223"
     variation       4788
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448380645"
     variation       4793
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1267909888"
     variation       4802..4803
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:935337355"
     variation       4804
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:4035254"
     variation       4805
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1487362870"
     variation       4806
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2347802"
     variation       4807
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759500246"
     variation       4809
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344509610"
     variation       4817
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466685611"
     variation       4820
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1417836849"
     variation       4827
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1272795753"
     variation       4829
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227702500"
     variation       4830..4833
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaca"
                     /replace="aacaaaca"
                     /db_xref="dbSNP:138419870"
     variation       4834
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:575553123"
     variation       4837
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4035255"
     variation       4839..4846
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ctac"
                     /replace="ctacctac"
                     /db_xref="dbSNP:1039867328"
     variation       4845
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:921429942"
     variation       4849
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1367331352"
     variation       4856
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1299042568"
     variation       4858
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1432021512"
     variation       4862
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1371976973"
     variation       4867
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2881731"
     variation       4871
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1166350685"
     variation       4872
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:15171"
     variation       4877
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1428509783"
     variation       4882
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1460143400"
     variation       4883
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1200904105"
     variation       4884
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1304300716"
     variation       4895
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1431421481"
     variation       4910
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:544408417"
     variation       4911
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1165469190"
     variation       4916
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1266598445"
     variation       4919
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1182586620"
     variation       4920
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355782680"
     variation       4931
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:934262098"
     variation       4932
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1204755699"
     variation       4934
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1051352075"
     variation       4935
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1257894431"
     variation       4942
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571528118"
     variation       4945
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1231178836"
     variation       4950
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886811300"
     variation       4960
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:964044349"
     variation       4964
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571528173"
     variation       4968
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1291307939"
     variation       4969
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1003801534"
     variation       4972
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:996499067"
     variation       4978
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1030219250"
     variation       4979
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1215129853"
     variation       4980
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1038102084"
     variation       4983
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1294917099"
     variation       4983
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:954731247"
     variation       4984
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1186341259"
     variation       4985..5001
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaaaaaa"
                     /replace="aaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaaaaaaaaaa"
                     /db_xref="dbSNP:rs748191385"
     variation       4985
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1305896320"
     variation       4993
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1012605123"
     variation       4997
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571528321"
     variation       4998..4999
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1329869812"
     variation       4998
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1558046028"
     variation       5001
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1198762322"
     variation       5002..5003
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1212507244"
     variation       5002
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1269294741"
     variation       5003
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1327518242"
     variation       5009
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1023241917"
     variation       5013
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571528387"
     variation       5018
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485515509"
     variation       5028
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12119896"
     variation       5032
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1340665187"
     variation       5033
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1265921878"
     variation       5035
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1393771885"
     variation       5037
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1404776593"
     variation       5040..5054
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttatta"
                     /replace="ttattatgtttatta"
                     /db_xref="dbSNP:1003236225"
     variation       5043
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1031552058"
     variation       5056
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478414648"
     variation       5064
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:529361977"
     variation       5068
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1409682295"
     variation       5075
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186491042"
     variation       5076..5090
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttcttttctt"
                     /replace="ttcttttcttttctt"
                     /db_xref="dbSNP:1473021622"
     variation       5078
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1418164873"
     variation       5079
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1426225899"
     variation       5082
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1177718809"
     variation       5083
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:956923689"
     variation       5109
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1375706305"
     variation       5111
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463885644"
     variation       5112..5122
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaaaaa"
                     /replace="aaaaaaaaaaa"
                     /replace="aaaaaaaaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /db_xref="dbSNP:58819847"
     variation       5116
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:542673149"
     variation       5121..5122
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1285563035"
     variation       5122
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:988117627"
     variation       5123..5135
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tgttttgt"
                     /replace="tgttttgttttgt"
                     /db_xref="dbSNP:1297620788"
     variation       5123
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:915342672"
     variation       5123
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:968154812"
     variation       5135..5138
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="t"
                     /replace="tgtt"
                     /db_xref="dbSNP:1386311964"
     variation       5140
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1317585144"
     variation       5151
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149358308"
     variation       5154
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:528463714"
     variation       5157..5162
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ggggg"
                     /replace="gggggg"
                     /replace="ggggggg"
                     /db_xref="dbSNP:1392666462"
     variation       5162
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1161672620"
     variation       5164..5170
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttttttt"
                     /replace="tttttttt"
                     /db_xref="dbSNP:1424324783"
     variation       5167
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1391027881"
     variation       5169
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:921473870"
     variation       5170
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1447759001"
     variation       5175
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:551697787"
     variation       5176
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1247929205"
     variation       5179
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1359872563"
     variation       5180
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571528710"
     variation       5188
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182844405"
     variation       5189
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1288246318"
     variation       5193
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1051793499"
     variation       5195
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908768879"
     variation       5201
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867401720"
     variation       5206
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1274950182"
     variation       5207
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1229908013"
     variation       5209
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:939701372"
     variation       5213
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1038026995"
     variation       5214
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437188912"
     variation       5219
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1332589070"
     variation       5222
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:531037350"
     variation       5224
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:898146104"
     variation       5226
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1170772770"
     variation       5227
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1044144167"
     variation       5230
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:907036636"
     variation       5232
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215621908"
     variation       5234
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1479257397"
     variation       5238
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1245492111"
     variation       5241
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240883900"
     variation       5242
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1483598598"
     variation       5247
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:867822394"
     variation       5248
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1032025653"
     variation       5251
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1395201047"
     variation       5257
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1219313734"
     variation       5262
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:955913385"
     variation       5263
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1011486266"
     variation       5268..5274
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttct"
                     /replace="ttcttct"
                     /db_xref="dbSNP:1453402948"
     variation       5270
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1350928472"
     variation       5275
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:536352013"
     variation       5276
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1408300795"
     variation       5283
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1381933310"
     variation       5285
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354178781"
     variation       5286
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:968039793"
     variation       5304
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:975531093"
     variation       5307
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:533211472"
     variation       5308
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:955733613"
     variation       5313
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1473104608"
     variation       5321
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114960248"
     variation       5328
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:908689527"
     variation       5331
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1479418866"
     variation       5333
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438650250"
     variation       5334
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:940298152"
     variation       5345
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775632556"
     variation       5347
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1443693497"
     variation       5357
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1276383609"
     variation       5358
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760654643"
     variation       5366
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1329592158"
     variation       5380
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1311750053"
     variation       5383..5387
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1351780762"
     variation       5390
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372824101"
     variation       5395
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974291658"
     variation       5404
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1303668649"
     variation       5406
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1450268136"
     variation       5416
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357538564"
     variation       5418
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1571529172"
     variation       5424
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1223606356"
     variation       5429
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458280886"
     variation       5437
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1391481930"
     variation       5451
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1157307086"
     variation       5456
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1418891239"
     variation       5464
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406722370"
     variation       5466
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:919626876"
     variation       5470
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473492291"
     variation       5473
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1240794392"
     variation       5483
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1202502951"
     variation       5494
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1465240213"
     variation       5495
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554691625"
     variation       5504
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:144730408"
     variation       5519
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1316174727"
     variation       5521
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571529315"
     variation       5526
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1313668948"
     variation       5536
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:566522040"
     variation       5537
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467694374"
     variation       5545
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:538630882"
     variation       5547
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1191289222"
     variation       5548
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314399225"
     variation       5555
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:938527220"
     variation       5558
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1367917876"
     variation       5566..5567
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:558782324"
     variation       5567
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:558929685"
     variation       5569
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12723035"
     variation       5573
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1453463821"
     variation       5574
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187111912"
     variation       5575
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764812680"
     variation       5578
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1383009466"
     variation       5585
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1406992840"
     variation       5586
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1021547385"
     variation       5587
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571529478"
     variation       5588
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:554715941"
     variation       5591
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249793506"
     variation       5594
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750078828"
     variation       5596
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148544292"
     variation       5597
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376221491"
     variation       5598
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543062977"
     variation       5599
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229167713"
     variation       5606
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1367499994"
     variation       5613
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1336614867"
     variation       5619
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1382217074"
     variation       5620
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1483820672"
     variation       5622
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1295589808"
     variation       5625
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:758829305"
     variation       5633
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:559410549"
     variation       5634
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1278124731"
     variation       5644
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:372152597"
     variation       5647
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1234434786"
     variation       5651
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1273110322"
     variation       5654
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1333445151"
     variation       5658
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:961517255"
     variation       5662
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974303277"
     variation       5664
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1192665367"
     variation       5666
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1268416175"
     variation       5667
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1274625696"
     variation       5668
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1206185262"
     variation       5671
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344395609"
     variation       5679
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:780366336"
     variation       5694
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:948407905"
     variation       5695
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313258215"
     variation       5708
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191566129"
     variation       5714
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304081906"
     variation       5723
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:979763801"
     variation       5726
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377612148"
     variation       5732
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184546154"
     variation       5747
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302139796"
     variation       5752
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1410114498"
     variation       5755
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1230947481"
     variation       5763..5766
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ca"
                     /replace="caca"
                     /db_xref="dbSNP:1558046789"
     variation       5764
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781697970"
     variation       5769
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:548221987"
     variation       5772
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370785680"
     variation       5785
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:531072286"
     variation       5786
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1053278828"
     variation       5787
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769851721"
     variation       5806
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1188500615"
     variation       5808
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773361630"
     variation       5816
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1484122639"
     variation       5817
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111404742"
     variation       5818
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:947172153"
     variation       5821
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1571529892"
     variation       5825
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042999528"
     variation       5826
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1258254026"
     variation       5830
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1222297521"
     variation       5837
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1558046848"
     variation       5840
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:900398155"
     variation       5844
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1289311183"
     variation       5847
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230624944"
     variation       5850
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1337120024"
     variation       5853
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868025826"
     variation       5857
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304438374"
     variation       5864
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1390286348"
     variation       5869
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1172875520"
     variation       5874
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304506692"
     variation       5878..5884
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaa"
                     /replace="aaaaaaaa"
                     /db_xref="dbSNP:80017588"
     variation       5884
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:996481212"
     variation       5897
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780960576"
     variation       5898
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1409593590"
     variation       5902
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1327183791"
     variation       5910
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:891116106"
     variation       5914
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1424471559"
     variation       5925
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373883472"
     variation       5928
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1558046935"
     variation       5931
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1558046937"
     variation       5938
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1258421433"
     variation       5939..5945
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aag"
                     /replace="aagcaag"
                     /db_xref="dbSNP:764394551"
     variation       5949
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461205653"
     variation       5952..5961
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaagaa"
                     /replace="aaagaaagaa"
                     /db_xref="dbSNP:1269355417"
     variation       5954
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1361197413"
     variation       5959
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749513422"
     variation       5964
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1349040979"
     variation       5977
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1015598005"
     variation       5987
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340714023"
     variation       5988
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1293159451"
     variation       5993
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354150536"
     variation       5994
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:974187069"
     variation       5999
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221045595"
     variation       6000
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1027205674"
     variation       6011
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1402202801"
     variation       6022
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1571530248"
     variation       6027
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772028969"
     variation       6029
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:970365954"
     variation       6032..6037
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aat"
                     /replace="aataat"
                     /db_xref="dbSNP:1370420984"
     variation       6036..6042
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="atga"
                     /replace="atgatga"
                     /db_xref="dbSNP:1270467167"
     variation       6038
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:561484585"
     variation       6040
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1249161644"
     variation       6061
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1191094438"
     variation       6063
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445630720"
     variation       6064
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189019083"
     variation       6074
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210816620"
     variation       6076
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1211375343"
     variation       6078
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356566690"
     variation       6084
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1571530353"
     variation       6097..6100
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tt"
                     /replace="tttt"
                     /db_xref="dbSNP:1293525408"
     variation       6100
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256596907"
     variation       6102..6107
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tttttt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:200183940"
     variation       6102
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1298239463"
     variation       6103
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1558047071"
     variation       6112
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:928360764"
     variation       6114..6121
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttttttt"
                     /replace="tttttttt"
                     /replace="ttttttttt"
                     /db_xref="dbSNP:959968547"
     variation       6114
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1373715756"
     variation       6115
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1553254349"
     variation       6122
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1161955936"
     variation       6123..6126
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1475129109"
     variation       6125
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1424063150"
     variation       6126
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190243054"
     variation       6129..6137
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="taaa"
                     /replace="taaaataaa"
                     /db_xref="dbSNP:912947858"
     variation       6131..6141
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaataaa"
                     /replace="aaataaataaa"
                     /db_xref="dbSNP:1171016040"
     regulatory      6136..6141
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /note="hexamer: AATAAA"
     variation       6140
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:947222942"
     variation       6144
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1242080116"
     variation       6149
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199967377"
     variation       6152
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1371782272"
     polyA_site      6153
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
     variation       6163
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1453737466"
     variation       6167
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900741905"
     variation       6173..6178
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tt"
                     /replace="ttactt"
                     /db_xref="dbSNP:749999220"
     variation       6173
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:932197377"
     variation       6176
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571530561"
     variation       6183
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1312619878"
     variation       6187
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142594726"
     variation       6188
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:887906952"
     variation       6189
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1402378278"
     variation       6199..6201
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1337318368"
     variation       6206
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:891135147"
     variation       6217
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1326432970"
     variation       6220
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1347206836"
     variation       6229
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755609686"
     variation       6231
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:562841172"
     variation       6235
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1371413015"
     variation       6236
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571530699"
     variation       6239..6290
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="ct"
                     /replace="ctacccctccccttttcttattattcagaatataaacctgcaaagctc
                     tgct"
                     /db_xref="dbSNP:1268007133"
     variation       6246
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1349565909"
     variation       6250
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896947437"
     variation       6251
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1013914189"
     variation       6258
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1279326667"
     variation       6261
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995537779"
     variation       6263
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027134098"
     variation       6273
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199165933"
     variation       6278
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1479866182"
     variation       6283
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484607121"
     variation       6288
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1023946354"
     variation       6308
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1435617372"
     variation       6309
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1272166128"
     variation       6320
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262362525"
     variation       6327
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1446450747"
     variation       6330
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:566559122"
     variation       6333
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1281074952"
     variation       6337
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1222707164"
     variation       6337
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:980384881"
     variation       6345
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1255004486"
     variation       6358
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1440074396"
     variation       6362
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354082485"
     variation       6368
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959739222"
     variation       6373
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1471211373"
     variation       6375
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1032936450"
     variation       6381..6384
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace=""
                     /replace="taat"
                     /db_xref="dbSNP:1404545952"
     variation       6384
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1454855514"
     variation       6392
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764156201"
     variation       6395
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:533769216"
     variation       6396
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761288537"
     variation       6397
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:913299221"
     variation       6406
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393650182"
     variation       6407
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968478422"
     variation       6423
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944822679"
     variation       6425
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1231869805"
     variation       6432
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:978503188"
     variation       6435
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1462544200"
     variation       6449
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1261204902"
     variation       6450
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:976151749"
     variation       6453
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538668935"
     variation       6457
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1571531065"
     variation       6464
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192705206"
     variation       6466..6474
                     /gene="PBX1"
                     /gene_synonym="CAKUHED"
                     /replace="aaaaaaa"
                     /replace="aaaaaaaa"
                     /replace="aaaaaaaaa"
                     /replace="aaaaaaaaaa"
                     /db_xref="dbSNP:921821272"
ORIGIN      
gatttgaagacaagcttgaaggataaaaagccttggtgcttcccaggagccgagccgaggagcagaagaggaagagccgggggctgccgtagcctttggagatggacgagcagcccaggctgatgcattcccatgctggggtcgggatggccggacaccccggcctgtcccagcacttgcaggatggggccggagggaccgagggggagggcgggaggaagcaggacattggagacattttacagcaaattatgaccatcacagaccagagtttggatgaggcgcaggccagttttgagtatccgaggagcccaggaggaggaacccacagacccccagctgatgcggctggacaacatgctgttagcggaaggcgtggcggggcctgagaagggcggagggtcggcggcagcggcggcagcggcggcggcttctggaggggcaggttcagacaactcagtggagcattcagattacagagccaaactctcacagatcagacaaatctaccatacggagctggagaaatacgagcaggcctgcaacgagttcaccacccacgtgatgaatctcctgcgagagcaaagccggaccaggcccatctccccaaaggagattgagcggatggtcagcatcatccaccgcaagttcagctccatccagatgcagctcaagcagagcacgtgcgaggcggtgatgatcctgcgttcccgatttctggatgcgcggcggaagagacggaatttcaacaagcaagcgacagaaatcctgaatgaatatttctattcccatctcagcaacccttaccccagtgaggaagccaaagaggagttagccaagaagtgtggcatcacagtctcccaggtatcaaactggtttggaaataagcgaatccggtacaagaagaacataggtaaatttcaagaggaagccaatatttatgctgccaaaacagctgtcactgctaccaatgtgtcagcccatggaagccaagctaactcgccctcaactcccaactcggctggttcttccagttcttttaacatgtcaaactctggagatttgttcatgagcgtgcagtcactcaatggggattcttaccaaggggcccaggttggagccaacgtgcaatcacaggtggatacccttcgccatgttatcagccagacaggaggatacagtgatggactcgcagccagtcagatgtacagtccgcagggcatcagtgctaatggaggttggcaggatgctactaccccttcatcagtgacctcccctacagaaggccctggcagtgttcactctgatacctccaactgatctcccagcaatcgcatcccggctgaccctgtgccccagttggggcaggggcaggagggagggtttctctcccaacgctgaagcggtcagactggaggtcgaagcaatcagcaaacacaataagagtctccttctcttctcttctttgggatgctatttcagccaatctggacacttctttatactctcttcccttttttttctgggtagaagccacccttccctgcctccagctgtcagcctggttttcgtcatcttccctgcccctgtgcctctgtcctagactcccggggtccccgccctctctcatatcactgaaggatattttcaacaattagaggaatttaaagaggaaaaaaattacaaagaaaataataaaagtgtttgtacgttttcatgctggtggtttgaggagccaaatttacctcactcgaatccctcactccctatgttaacaggcaatccttctctgtttctcttattactctcactacctcttagcaggaatactccacattgccctattcattccaggcctccctgcttcctcttgctcttcctccctggggacagtactgattggaacactttcctcctcttccttcctagccccagctattcactggggactgtcatagctgggattctaaaggtgccacatttttcagtttcatctccactaggttggttcccgggcaggaagtcaggcagcagggaaggacacgggaacagcaggtggagaattcctacagtctttcttaccctgctagcaatagctctcagtttcagaggcacagtctttggagaccattcagcactgagaaagcaatatttagaacctattgcaaaactgggcctgagttaggcatggtgatgaatgcatcagcaaggaatagaaagttcttatcgtgaaacccttcaacctcaactatgccttcatagacacacacgttcatgcacatgtaggcacatgtaccatctcacatcttcactttcccgagatgccatatacaattacctacattaataactgtagcactatgccttttgagcccgagagagggaattagtgactctaagtgaaggtcactgacacagagaagcagtatgtgtctggggcttccaggacctgcaggcccactagcgtgcacttaccagaatggcatacacaggacctgatcatgaggaagaccaggtttccagtgtaaactactcttgttcccaccacctctggagcactcagggagccccatacagtacttacaatgtctttaatggacttgattctgtttaattttttgttttatattaggcacactgtattaattttccaaaatgttataccacactatgttcttggtcctgacctattgctctggaggaaagagttgtataagaacgtggctcatgtgaacttttgctagcttcatttgaggacctgagaatcatggggaaagggaaggtaatgttttcattgaaatcatcacagtgatttttattccctgggaacacagcgtgtactaaaaatacatgagaaaatagcatgtatatgaaagctattctcaaaagtcacctgagctcaccatcttcatagccaaccctaccagttataaagatggcagctctatcacttgattaagtgggaggtggtcaaatattttggtgcctcattttcttcatctgtgagatgggaactgttatgcctggcttactaagagtcttgtgagagactgagaagttgattttgttcatatccaatctgtaaatgcgaagtcaggggaagtaatgtccctgaaataaacgggttcatgccatctagggacaataaatggttttcttgttgtaacttctggttaatatcagtaccttgatgtcatcaccgtgatgacaaagagaagagttattgttgatcttcttggttttggtctgtctcttttcttaggataaagaaaaacttccaaactagaaaaacaggccctggttcccttagtttgcacttgaacccaatatgttgccttgtacatacttggtccctgtcacattgactgcttgggaggcttccagggagaagtatgagaccctgaggggtgagaatgggcagctagcaagaacatggaaattctgcttggcactacagtcataaatagaaaacactgtgtgtgctcaggggagcaggggatgccactgaagaaactcaagggaatgtgtatttgaaggaaatgcaaaaactaagtatttagcaaaatgaaattatgccttgatgactaaaaggcactagaaaggttgtgtctactaacttcagccctaatcagaacagatgcctagaaggagcatttttgtgacaacttcatagtgattagaatcagtggagaactccatcttagtggcaggaatataatgaaactacccacgcaagaacatggttgaatcacatttgcttgacttagggcaaagtacgaaagagagacaaaagggttctcttggaaacaagaagagtgactccagatgtggcctgaataattgccatgttaagttaatgcaaaagatcagaacagggctacatttgcacaggcagtttctctccgggccgtagttttcactgatgatcacctttcacagcattttccccaaccagcatttcacttagtcttctctatacccagcacctcccccggcacccccggcaagcccactatcacttccgacttccaacgtggcatccgtgagatctgtccacattaggcgaagcaggagaacactgagagcagcaggatgggtttggaaagagcatgcctctggaaacacagcttcctgggaattcacatgaggccagtcctacagagagcaagatgcaccccaggatttcttcattttctaatagatgtgggagtgctccattttccccgacagcgaatttcccctgagaaacgatactagaccctgggtttgcccaccttgtaactcttccttatctcctccttttcatccctaatccatcctccctctggcatggaattgacgcccgtgcagtacatttgccaagtggcaccttctttcaatttatgttttattttgctatggtggtgattctttatttgctggttgtcttttctcacacatctttctctctgtctctctctttcctgctctttgtttttctgcccagaaaaacctgacttcgataccaaaaaagatgaaactacagaaactcaaatttaaaaaaaactttaaaagaaacaaaaaaatactcaacgattctttcagctttattaacattttccattgtttcttgcgacttgtgtctcgttctttgtagtattgatgatgaacatttgataatgaatgttcttgtatattcagataaagaaaaaaaaaaccaaaaaagcggtctgaatttaatagtgtttataataaaaattttaaaaatgaccctcatagcacgcaaaacaggatggggaatttcccctcttctttctgtgacaatgcgcatcattcctgcattagtttttaacaccagactacctacattcatcatttccctcatttttcttttattttcttgcatttgtgaattagttcaagaatgctagaaaagtgtcgagttgtgcacatccatttcttgtttcacaatgtttaaaagtgacagtaattcattttgtaaactaaaaaaaaaaaaaaaaaggttggaatagtgagcataataggtacaacctaacacattattatgtttattaactttgagacccagaaataaattcttttcttttcttgattcttgctcttaaaaatacaaaaaaaaaaatgttttgttttgtgttatttttggtttgtttattggggggctttttttaattgtcaggattatgatcttgctgtttttcttcaatatgtatacaaggtgatgtgaaaagatgacttgggcagaggagtaagaacaagtaggcttgttcttctactttgcttcagaattcagttaatgccaaaagcgaagatcaagcccatgttgatgtctcgttgctcacctgcatttccagagagtgtgacactcatgcagtccctgagaaaaataaaatcagggacatacttctccttttagccttttaaaaattcaaaaacgtttagtccaagggaactttttatgctatcaggaaaggtttttgctgtttttgattctgattatcacagccaagtactttgttttatttctccctaattaataactacattccatgaggcctcttccaaccaaagaggccttttcttccaggagagtcccgcaggagatgctggtatgatgggcaccattggttaagtaaactacatgcaggaagaagtccttggggccagtctgccagctgagtcctggttttggatgaagagttaatgagatattgggccaggctcaatgctgtagttttaatgctaagaggttacgtttacttcacagagtacacctcttagtaacctctgacttaggcagctgcttaaagcaaattgcaaaactggcttgatttggaatgtttttattagaggaaaaaagaaagccatattatctggaaaaaaattcattttaaataccatcattcaacaaattatgttcagaaagtggtcagaacttaagcaagaaaagtaaagaaagaatgcagaattgtggagcaatgctttaggaaatatttctacctgaacacttgtactcttgaagtcacaacaaaataatgatgagcttttcacatcacctttatggtttcaatccctagctcaaagcttcctggaatcttttattttttgtaaacttttttttcttttgttaaaataaataaaacattcaatgtttttctccttttctctcttattacttctttcctttggcattttcaatttgaaatgctttcctttggttgttggttttattctccccctacccctccccttttcttattattcagaatataaacctgcaaagctctgctctgttttggttttgaaagtttaagcttttctgcttctgtgagagcacaggcttctgtcccttttgattccaactgaacttttgtgttctctaatgatactaacacggtgtaggttttacagtctcctaatttgtactggtaatgcatattccaaataaatagtttcttttgttgcaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]