GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 05:28:34, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001346116            1343 bp    mRNA    linear   PRI 14-SEP-2018
DEFINITION  Homo sapiens pseudouridine synthase like 1 (PUSL1), transcript
            variant 1, mRNA.
ACCESSION   NM_001346116
VERSION     NM_001346116.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1343)
  AUTHORS   Zaganelli S, Rebelo-Guiomar P, Maundrell K, Rozanska A, Pierredon
            S, Powell CA, Jourdain AA, Hulo N, Lightowlers RN,
            Chrzanowska-Lightowlers ZM, Minczuk M and Martinou JC.
  TITLE     The Pseudouridine Synthase RPUSD4 Is an Essential Component of
            Mitochondrial RNA Granules
  JOURNAL   J. Biol. Chem. 292 (11), 4519-4532 (2017)
   PUBMED   28082677
REFERENCE   2  (bases 1 to 1343)
  AUTHORS   Jostins L, Ripke S, Weersma RK, Duerr RH, McGovern DP, Hui KY, Lee
            JC, Schumm LP, Sharma Y, Anderson CA, Essers J, Mitrovic M, Ning K,
            Cleynen I, Theatre E, Spain SL, Raychaudhuri S, Goyette P, Wei Z,
            Abraham C, Achkar JP, Ahmad T, Amininejad L, Ananthakrishnan AN,
            Andersen V, Andrews JM, Baidoo L, Balschun T, Bampton PA, Bitton A,
            Boucher G, Brand S, Buning C, Cohain A, Cichon S, D'Amato M, De
            Jong D, Devaney KL, Dubinsky M, Edwards C, Ellinghaus D, Ferguson
            LR, Franchimont D, Fransen K, Gearry R, Georges M, Gieger C, Glas
            J, Haritunians T, Hart A, Hawkey C, Hedl M, Hu X, Karlsen TH,
            Kupcinskas L, Kugathasan S, Latiano A, Laukens D, Lawrance IC, Lees
            CW, Louis E, Mahy G, Mansfield J, Morgan AR, Mowat C, Newman W,
            Palmieri O, Ponsioen CY, Potocnik U, Prescott NJ, Regueiro M,
            Rotter JI, Russell RK, Sanderson JD, Sans M, Satsangi J, Schreiber
            S, Simms LA, Sventoraityte J, Targan SR, Taylor KD, Tremelling M,
            Verspaget HW, De Vos M, Wijmenga C, Wilson DC, Winkelmann J, Xavier
            RJ, Zeissig S, Zhang B, Zhang CK, Zhao H, Silverberg MS, Annese V,
            Hakonarson H, Brant SR, Radford-Smith G, Mathew CG, Rioux JD,
            Schadt EE, Daly MJ, Franke A, Parkes M, Vermeire S, Barrett JC and
            Cho JH.
  CONSRTM   International IBD Genetics Consortium (IIBDGC)
  TITLE     Host-microbe interactions have shaped the genetic architecture of
            inflammatory bowel disease
  JOURNAL   Nature 491 (7422), 119-124 (2012)
   PUBMED   23128233
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL139287.24.
            
            Transcript Variant: This variant (1) represents the longest
            transcript and encodes the longer isoform (1).
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1163657.583519.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1968968, SAMEA2145122
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-141               AL139287.24        8533-8673
            142-199             AL139287.24        8868-8925
            200-387             AL139287.24        9039-9226
            388-537             AL139287.24        9407-9556
            538-708             AL139287.24        9634-9804
            709-763             AL139287.24        10587-10641
            764-995             AL139287.24        10793-11024
            996-1343            AL139287.24        11283-11630
FEATURES             Location/Qualifiers
     source          1..1343
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="1"
                     /map="1p36.33"
     gene            1..1343
                     /gene="PUSL1"
                     /note="pseudouridine synthase like 1"
                     /db_xref="GeneID:126789"
                     /db_xref="HGNC:HGNC:26914"
     exon            1..141
                     /gene="PUSL1"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1446246884"
     variation       3
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1475695362"
     variation       4..14
                     /gene="PUSL1"
                     /replace="cgcgcgcgc"
                     /replace="cgcgcgcgcgc"
                     /replace="cgcgcgcgcgcgc"
                     /replace="cgcgcgcgcgcgcgc"
                     /db_xref="dbSNP:1190723168"
     variation       6
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1293031141"
     variation       7
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1168632825"
     variation       8
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1335981318"
     variation       9
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:966862181"
     variation       12
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165723973"
     variation       14
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781429529"
     variation       16..17
                     /gene="PUSL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:774340045"
     variation       16
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382049919"
     variation       17
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:529676589"
     variation       19
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1432100567"
     variation       21
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1353271319"
     variation       24
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769979648"
     variation       25
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780171796"
     variation       26
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1293826618"
     variation       27
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290953565"
     variation       29
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749431836"
     variation       30
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1225308682"
     variation       31
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:772106973"
     variation       33
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371884242"
     variation       34
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263578799"
     variation       36
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1200029508"
     variation       37
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916567629"
     variation       38
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566370557"
     variation       39
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538919886"
     variation       40
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1189336923"
     misc_feature    41..43
                     /gene="PUSL1"
                     /note="upstream in-frame stop codon"
     variation       42
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1369320379"
     variation       44
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263069375"
     variation       45
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202246441"
     variation       48
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759221622"
     variation       49
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1374248915"
     variation       51
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1462193808"
     variation       53
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764853687"
     variation       54
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752179979"
     variation       55..57
                     /gene="PUSL1"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1553165294"
     variation       57
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:762489649"
     variation       58
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763621677"
     variation       59
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1339723443"
     variation       60
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1380405690"
     variation       62
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757716004"
     CDS             65..1045
                     /gene="PUSL1"
                     /note="isoform 1 is encoded by transcript variant 1; tRNA
                     pseudouridine synthase-like 1; tRNA-uridine isomerase-like
                     1; pseudouridylate synthase like 1; tRNA pseudouridylate
                     synthase-like 1"
                     /codon_start=1
                     /product="tRNA pseudouridine synthase-like 1 isoform 1"
                     /protein_id="NP_001333045.1"
                     /db_xref="GeneID:126789"
                     /db_xref="HGNC:HGNC:26914"
                     /translation="
MSSAPASGSVRARYLVYFQYVGTDFNGVAAVRGTQRAVGVQNYLEEAAERLNSVEPVRFTISSRTDAGVHALSNAAHLDVQRRSGRPPFPPEVLAEALNTHLRHPAIRVLRAFRVPSDFHARHAATSRTYLYRLATGCHRRDELPVFERNLCWTLPADCLDMVAMQEAAQHLLGTHDFSAFQSAGSPVPSPVRTLRRVSVSPGQASPLVTPEESRKLRFWNLEFESQSFLYRQVRRMTAVLVGHGRLWVTGGSGSQVRRMTAVLVAVGLGALAPAQVKTILESQDPLGKHQTRVAPAHGLFLKSVLYGNLGAASCTLQGPQFGSHG"
     variation       65
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781550889"
     variation       66
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756340645"
     variation       67
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:929145198"
     variation       70
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568992693"
     variation       71
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262065761"
     variation       72
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749556442"
     variation       74
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1212000768"
     variation       75
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368548181"
     variation       76
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1479719168"
     variation       77
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:983267902"
     variation       78
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1485192589"
     variation       80
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779148624"
     variation       84
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1263231801"
     variation       85
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428589843"
     variation       86
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746879486"
     variation       87
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770842424"
     variation       89
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:776472630"
     variation       90
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745698070"
     variation       91..96
                     /gene="PUSL1"
                     /replace="cgtgcg"
                     /replace="cgtgcgtgcg"
                     /db_xref="dbSNP:1557618811"
     variation       91
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:931560648"
     variation       92
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1385171240"
     variation       94..103
                     /gene="PUSL1"
                     /replace="gcgcgcgc"
                     /replace="gcgcgcgcgc"
                     /replace="gcgcgcgcgcgc"
                     /db_xref="dbSNP:748012075"
     variation       94
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1174050727"
     variation       95
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1038909731"
     variation       96
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372173486"
     variation       97
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1165898363"
     variation       98
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1366623894"
     variation       103
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:537652358"
     variation       105
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762611505"
     variation       107
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374791936"
     variation       112
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763534184"
     variation       115
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773853169"
     variation       118
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1389128473"
     variation       121
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373506061"
     variation       124
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:554609421"
     variation       125
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1309008526"
     variation       127
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:932959204"
     variation       128
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767960561"
     variation       130
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750772669"
     variation       132
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1485937260"
     variation       133
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537537346"
     variation       138
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754056496"
     exon            142..199
                     /gene="PUSL1"
                     /inference="alignment:Splign:2.1.0"
     variation       143
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1444588956"
     variation       146
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766784524"
     variation       153
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1299123847"
     variation       155
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:867092754"
     variation       159..182
                     /gene="PUSL1"
                     /replace="ggggcactcagcgcgccgtcgggg"
                     /replace="ggggcactcagcgcgccgtcgggggcactcagcgcgccgtcgggg"
                     /db_xref="dbSNP:1553165364"
     variation       159
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:867477854"
     variation       162
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868512811"
     variation       164
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754322371"
     variation       170
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200089551"
     variation       171
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1336373753"
     variation       173
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1177429105"
     variation       174
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:531910951"
     variation       175
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1271626529"
     variation       177
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776421240"
     variation       178
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1305424582"
     variation       179
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777930211"
     variation       181
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1233249833"
     variation       182
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750267398"
     variation       186
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756047449"
     variation       187
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042560386"
     variation       188..189
                     /gene="PUSL1"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:776051014"
     variation       195
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779818166"
     variation       196
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1381912672"
     exon            200..387
                     /gene="PUSL1"
                     /inference="alignment:Splign:2.1.0"
     variation       201
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448850948"
     variation       203
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1191531382"
     variation       205
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216628504"
     variation       208
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747688345"
     variation       211
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467320033"
     variation       212
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:924986687"
     variation       217
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016988497"
     variation       219
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:367791366"
     variation       222
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1396135883"
     variation       223
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777135912"
     variation       224
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1157390270"
     variation       225
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:963560434"
     variation       227
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:936415510"
     variation       229
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1401759345"
     variation       230
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1320673830"
     variation       231
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746568979"
     variation       232
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1438270252"
     variation       233
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771532203"
     variation       238
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777236653"
     variation       239
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1238016758"
     variation       243..244
                     /gene="PUSL1"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:921881930"
     variation       243
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1054939718"
     variation       247
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760141691"
     variation       248
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:916438607"
     variation       249
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:532019960"
     variation       252
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467189767"
     variation       253
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775923867"
     variation       255
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763079213"
     variation       259
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1253844291"
     variation       262
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437656858"
     variation       265
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764432483"
     variation       267
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1557620023"
     variation       268
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1234914573"
     variation       271
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:774267070"
     variation       273
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164755008"
     variation       275
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374385109"
     variation       277
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459390383"
     variation       280
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1048397196"
     variation       283
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1417479846"
     variation       284
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1431652222"
     variation       287
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753721142"
     variation       289
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1391037432"
     variation       290
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:934964804"
     variation       292
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754914300"
     variation       295
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1222658720"
     variation       296
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764937483"
     variation       298
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1337239981"
     variation       299
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1325931091"
     variation       301
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377475934"
     variation       302
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1292585828"
     variation       305
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1006948064"
     variation       307
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757967278"
     variation       311
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1018380057"
     variation       312
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1235180787"
     variation       314
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1266067865"
     variation       315
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777520065"
     variation       316
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746689455"
     variation       320
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756777758"
     variation       321..322
                     /gene="PUSL1"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:757635289"
     variation       321
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780861891"
     variation       322
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438752500"
     variation       323
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746305517"
     variation       324
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1045224696"
     variation       325
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:965547627"
     variation       329..340
                     /gene="PUSL1"
                     /replace=""
                     /replace="ttcccgcccgag"
                     /db_xref="dbSNP:767805036"
     variation       330..344
                     /gene="PUSL1"
                     /replace="tcc"
                     /replace="tcccgcccgaggtcc"
                     /db_xref="dbSNP:749702323"
     variation       332
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1047308029"
     variation       333
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:557118889"
     variation       335
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:887118859"
     variation       336..353
                     /gene="PUSL1"
                     /replace="ccgagg"
                     /replace="ccgaggtcctggccgagg"
                     /db_xref="dbSNP:756243044"
     variation       336
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775701586"
     variation       337
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749709428"
     variation       341
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768935562"
     variation       343..357
                     /gene="PUSL1"
                     /replace="cct"
                     /replace="cctggccgaggccct"
                     /db_xref="dbSNP:780302427"
     variation       343
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165153470"
     variation       344
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:774510613"
     variation       345
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762039630"
     variation       347
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1391916448"
     variation       348
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967659446"
     variation       349
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767523022"
     variation       350
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:964146886"
     variation       351
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1435247905"
     variation       353
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1272119566"
     variation       354
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:773348239"
     variation       355
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1176918633"
     variation       356
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978129488"
     variation       357
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568827321"
     variation       359
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313715309"
     variation       361
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201364779"
     variation       364
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752405681"
     variation       365
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1246553420"
     variation       366
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:554322863"
     variation       367
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:957753658"
     variation       368
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1028779998"
     variation       369
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1374407110"
     variation       370
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:990595164"
     variation       372
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12094447"
     variation       373
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373334372"
     variation       377
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:202024784"
     variation       378
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756974183"
     variation       379
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780841268"
     variation       380
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200293027"
     variation       385
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1422069519"
     variation       386
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866708541"
     variation       387
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1380570226"
     exon            388..537
                     /gene="PUSL1"
                     /inference="alignment:Splign:2.1.0"
     variation       389
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1189910628"
     variation       390
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562174379"
     variation       391
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250614383"
     variation       392
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760250451"
     variation       395
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765909677"
     variation       397
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753351838"
     variation       399..404
                     /gene="PUSL1"
                     /replace="cc"
                     /replace="ccttcc"
                     /db_xref="dbSNP:755072089"
     variation       399
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150971662"
     variation       400
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753236587"
     variation       404
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:531499922"
     variation       405
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:548120262"
     variation       406
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:901233168"
     variation       407
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:939522758"
     variation       411
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150020894"
     variation       412
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1309215856"
     variation       414
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1375393313"
     variation       415
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1413409113"
     variation       421
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1290905977"
     variation       425
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1380697381"
     variation       426
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781318251"
     variation       428
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1294380823"
     variation       429
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141244792"
     variation       434
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774614565"
     variation       440
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323914009"
     variation       441
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774389335"
     variation       442
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485313293"
     variation       443
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1260701087"
     variation       444
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1463922964"
     variation       445
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748112004"
     variation       446
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248110283"
     variation       447
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771927051"
     variation       448
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772948250"
     variation       450
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368279935"
     variation       451
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1417601007"
     variation       453
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1451519283"
     variation       457
                     /gene="PUSL1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:779005704"
     variation       459
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765999979"
     variation       460
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144956110"
     variation       461
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903376939"
     variation       462
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372368583"
     variation       464
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764751925"
     variation       465
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753142532"
     variation       467
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1359460108"
     variation       468
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758908093"
     variation       469
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764512107"
     variation       470
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1346879624"
     variation       473
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751923165"
     variation       474
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757478910"
     variation       477..483
                     /gene="PUSL1"
                     /replace="g"
                     /replace="gtcaccg"
                     /db_xref="dbSNP:866592821"
     variation       478
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781308823"
     variation       479
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1447340783"
     variation       480
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1557621173"
     variation       481..482
                     /gene="PUSL1"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1557621183"
     variation       485
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:533752936"
     variation       486
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756211671"
     variation       491
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1381583033"
     variation       493
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:894731516"
     variation       494
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780287207"
     variation       496
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:574796043"
     variation       497
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1011883903"
     variation       498
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1051144368"
     variation       499
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:891193508"
     variation       500
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1309290723"
     variation       504
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748094039"
     variation       506
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772194557"
     variation       509
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373356459"
     variation       510
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201259777"
     variation       511
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1030785760"
     variation       512..513
                     /gene="PUSL1"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1157751456"
     variation       513
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770793993"
     variation       514
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776100443"
     variation       517
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238903782"
     variation       518
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376409060"
     variation       519
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371253444"
     variation       520
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764658227"
     variation       523
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:970441624"
     variation       525
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763432233"
     variation       527
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764557732"
     variation       528
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751920250"
     variation       529
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757521584"
     variation       531
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:767945512"
     variation       532
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376174027"
     variation       534
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1557621370"
     variation       535
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1467278742"
     variation       536
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756473143"
     variation       537
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371158985"
     exon            538..708
                     /gene="PUSL1"
                     /inference="alignment:Splign:2.1.0"
     variation       538
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:769404665"
     variation       540
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1330818078"
     variation       543..545
                     /gene="PUSL1"
                     /replace="tgg"
                     /replace="tggtgg"
                     /db_xref="dbSNP:770533744"
     variation       543
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779641977"
     variation       544
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1203494083"
     variation       548
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748959537"
     variation       553
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1483677666"
     variation       556
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210787669"
     variation       560
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1272694243"
     variation       561
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:767991354"
     variation       562
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1440172246"
     variation       563
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1189233836"
     variation       565
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:941491832"
     variation       566
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773979579"
     variation       568
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762216123"
     variation       569
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772684213"
     variation       570
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:903345934"
     variation       571
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:773682015"
     variation       573
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1312186030"
     variation       574
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1400223467"
     variation       575
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1397830006"
     variation       576
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1557621750"
     variation       577
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201643214"
     variation       578
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:932679778"
     variation       579
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1051034793"
     variation       581
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:144003672"
     variation       582
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766875882"
     variation       583
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:894700846"
     variation       584
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148995795"
     variation       587
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759812092"
     variation       589
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:576551356"
     variation       591..595
                     /gene="PUSL1"
                     /replace="ac"
                     /replace="acgac"
                     /db_xref="dbSNP:776346419"
     variation       592
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369580147"
     variation       595
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781143448"
     variation       596
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750390825"
     variation       598
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:755853505"
     variation       601
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1186276447"
     variation       602
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326165072"
     variation       604
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779836439"
     variation       605
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:905094174"
     variation       607
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1172981137"
     variation       612
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1557621889"
     variation       613
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754719312"
     variation       614
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467480577"
     variation       615
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1173252542"
     variation       618
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1025432408"
     variation       621
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778266752"
     variation       623
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1433236830"
     variation       624
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747735879"
     variation       625
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771742963"
     variation       626
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773810889"
     variation       629..630
                     /gene="PUSL1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1299579386"
     variation       630
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1206669897"
     variation       631..649
                     /gene="PUSL1"
                     /replace="gagccccgtgcgaacgctg"
                     /replace="gagccccgtgcgaacgctgagccccgtgcgaacgctg"
                     /db_xref="dbSNP:1557621975"
     variation       631
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747533976"
     variation       635
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201576432"
     variation       637
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:187699906"
     variation       638
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016738175"
     variation       639
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:541286911"
     variation       640
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765541305"
     variation       641
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775397239"
     variation       642
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1472045057"
     variation       644..645
                     /gene="PUSL1"
                     /replace="ac"
                     /replace="acac"
                     /db_xref="dbSNP:1465038077"
     variation       645
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190432704"
     variation       646
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1264933825"
     variation       649
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1434846624"
     variation       651
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370315341"
     variation       653
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:34738574"
     variation       654
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766150586"
     variation       655
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1319059069"
     variation       657..660
                     /gene="PUSL1"
                     /replace="tctc"
                     /replace="tctctc"
                     /db_xref="dbSNP:1161407835"
     variation       660..661
                     /gene="PUSL1"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:759029499"
     variation       660
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753718317"
     variation       661
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1461064487"
     variation       662
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:922595092"
     variation       665
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754556794"
     variation       667
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:545931077"
     variation       669
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1387919918"
     variation       671..673
                     /gene="PUSL1"
                     /replace="ggc"
                     /replace="ggcggc"
                     /db_xref="dbSNP:1284574524"
     variation       671
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:535366534"
     variation       673..674
                     /gene="PUSL1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1349381816"
     variation       674
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1226075915"
     variation       678
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757928080"
     variation       682..685
                     /gene="PUSL1"
                     /replace="cccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:1423537076"
     variation       682
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1329451080"
     variation       684
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:924683612"
     variation       685
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:921559723"
     variation       688
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1331366760"
     variation       692
                     /gene="PUSL1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1489325232"
     variation       693..697
                     /gene="PUSL1"
                     /replace="cccc"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:764750132"
     variation       693
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210396117"
     variation       694
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1251025887"
     variation       696
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:747517367"
     variation       697
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:562137028"
     variation       698..703
                     /gene="PUSL1"
                     /replace="gag"
                     /replace="gaggag"
                     /db_xref="dbSNP:1189795058"
     variation       698
                     /gene="PUSL1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:774845482"
     variation       698
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:986804642"
     variation       700
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:936096199"
     variation       701
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776835978"
     variation       703
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746279499"
     variation       705
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377510824"
     variation       706
                     /gene="PUSL1"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1453912201"
     variation       706
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:531217791"
     variation       708
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221783817"
     exon            709..763
                     /gene="PUSL1"
                     /inference="alignment:Splign:2.1.0"
     variation       709
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769665606"
     variation       712
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775389621"
     variation       713
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:79155839"
     variation       714
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:985247663"
     variation       715
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886414579"
     variation       716
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201507216"
     variation       717
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145899282"
     variation       718
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:767049785"
     variation       723
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756614612"
     variation       724
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:976541633"
     variation       725
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1224492850"
     variation       727
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766756908"
     variation       728
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754367701"
     variation       730
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1180830970"
     variation       731
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755279054"
     variation       733
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181405526"
     variation       737
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368461153"
     variation       739
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1389791840"
     variation       741
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372427823"
     variation       742
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1325241334"
     variation       743
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747095696"
     variation       744
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771069881"
     variation       746
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775516342"
     variation       747
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375410849"
     variation       750
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368390886"
     variation       751
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1240080534"
     variation       752
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1283796816"
     variation       753
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773060240"
     variation       754
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768497084"
     variation       757
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:563462883"
     variation       758
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1029103812"
     variation       760
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1483022585"
     variation       761
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203612460"
     variation       762
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211347817"
     variation       763
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761512844"
     exon            764..995
                     /gene="PUSL1"
                     /inference="alignment:Splign:2.1.0"
     variation       764
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1401141821"
     variation       765..766
                     /gene="PUSL1"
                     /replace=""
                     /replace="ggctctgggtc"
                     /db_xref="dbSNP:1491286314"
     variation       765..766
                     /gene="PUSL1"
                     /replace=""
                     /replace="ta"
                     /db_xref="dbSNP:1491546037"
     variation       766..768
                     /gene="PUSL1"
                     /replace=""
                     /replace="acg"
                     /db_xref="dbSNP:150402347"
     variation       767
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:540871258"
     variation       768..819
                     /gene="PUSL1"
                     /replace="gg"
                     /replace="ggaggatgacggctgtgctggtgggtcacgggcggctctgggtcacag
                     gtgg"
                     /db_xref="dbSNP:1557624091"
     variation       768
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780771123"
     variation       771
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1341194322"
     variation       772
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:565784306"
     variation       773
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:769224759"
     variation       777
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775130201"
     variation       778
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:976869002"
     variation       779
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:534454813"
     variation       781
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1280089453"
     variation       782
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769253707"
     variation       784
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:940735332"
     variation       785
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:557713640"
     variation       786
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1193770977"
     variation       789..813
                     /gene="PUSL1"
                     /replace="tgggtcac"
                     /replace="tgggtcacgggcggctctgggtcac"
                     /db_xref="dbSNP:769326814"
     variation       790
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:978435360"
     variation       791..792
                     /gene="PUSL1"
                     /replace=""
                     /replace="cc"
                     /replace="ccgt"
                     /db_xref="dbSNP:774933757"
     variation       791
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201527149"
     variation       792
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768008495"
     variation       794..796
                     /gene="PUSL1"
                     /replace=""
                     /replace="cac"
                     /db_xref="dbSNP:772609005"
     variation       795
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283296396"
     variation       796
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773502224"
     variation       797
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761045791"
     variation       799..801
                     /gene="PUSL1"
                     /replace="g"
                     /replace="gcg"
                     /db_xref="dbSNP:773694006"
     variation       800
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766357941"
     variation       801..834
                     /gene="PUSL1"
                     /replace="ggctctgggtcacaggt"
                     /replace="ggctctgggtcacaggtggctctgggtcacaggt"
                     /db_xref="dbSNP:142589758"
     variation       801
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:537301128"
     variation       805
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209213063"
     variation       806
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1265207695"
     variation       807
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758241030"
     variation       809
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764055570"
     variation       814
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200689011"
     variation       817
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201592879"
     variation       818..860
                     /gene="PUSL1"
                     /replace="ggctctgggtcacaggtacggaggatgacggctgtgctggtgg"
                     /replace="ggctctgggtcacaggtacggaggatgacggctgtgctggtgggtcac
                     gggcggctctgggtcacgggcggctctgggtcacaggtacggaggatgacggctgtgc
                     tggtgg"
                     /db_xref="dbSNP:1557624214"
     variation       818..838
                     /gene="PUSL1"
                     /replace="g"
                     /replace="ggctctgggtcacaggtacgg"
                     /db_xref="dbSNP:1369456562"
     variation       818..834
                     /gene="PUSL1"
                     /replace="ggctctgggtcacaggt"
                     /replace="ggctctgggtcacaggtgaggatgacggctgtgctggtgggtcacggg
                     cggctctgggtcacaggt"
                     /db_xref="dbSNP:766698508"
     variation       818
                     /gene="PUSL1"
                     /replace="g"
                     /replace="gaggatgacggctgtgctggtgggtcacgggcg"
                     /db_xref="dbSNP:1553166112"
     variation       819..835
                     /gene="PUSL1"
                     /replace=""
                     /replace="gctctgggtcacaggta"
                     /db_xref="dbSNP:759750839"
     variation       820
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200051764"
     variation       824
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369638348"
     variation       825
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745513702"
     variation       826
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:991750786"
     variation       828
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200679995"
     variation       833
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779407926"
     variation       835..837
                     /gene="PUSL1"
                     /replace=""
                     /replace="acg"
                     /db_xref="dbSNP:149584797"
     variation       836
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748869074"
     variation       837
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:571929121"
     variation       840
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774864463"
     variation       841
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61740325"
     variation       842
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1557624274"
     variation       843
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772562823"
     variation       846
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773772204"
     variation       847
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:41285824"
     variation       848
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1349332170"
     variation       849
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1031212124"
     variation       851
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1226231209"
     variation       852
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766667591"
     variation       855
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776753262"
     variation       856..860
                     /gene="PUSL1"
                     /replace="ggtgg"
                     /replace="ggtgggtgg"
                     /db_xref="dbSNP:1455471269"
     variation       856
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759616358"
     variation       857
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:930748057"
     variation       859
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765240675"
     variation       861
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1243829642"
     variation       862
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751428433"
     variation       863
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139201590"
     variation       867
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:968476824"
     variation       870
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750265978"
     variation       871
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373430494"
     variation       874
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1169536440"
     variation       875
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1402594729"
     variation       876
                     /gene="PUSL1"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:752861165"
     variation       879
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779715243"
     variation       882
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377703888"
     variation       883
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1369046034"
     variation       886
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754444150"
     variation       887
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1251554386"
     variation       888
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1423396612"
     variation       890
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163138668"
     variation       892
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:564930331"
     variation       893
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1425923164"
     variation       895
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368157004"
     variation       897
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772757160"
     variation       898
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1407477092"
     variation       900
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773683958"
     variation       901
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747362903"
     variation       904
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149289867"
     variation       905
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776859087"
     variation       910
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:907820810"
     variation       912
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759678268"
     variation       916
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769910729"
     variation       917
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142154083"
     variation       918
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1557624474"
     variation       920
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:561268805"
     variation       921
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767482018"
     variation       922
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368888817"
     variation       924
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1180332191"
     variation       927
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020563882"
     variation       928
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1445593406"
     variation       929
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188270713"
     variation       930
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164310717"
     variation       931
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1392310703"
     variation       934
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144555782"
     variation       939
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1483929177"
     variation       940
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1412065755"
     variation       941
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753524444"
     variation       942
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778545872"
     variation       943
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202764333"
     variation       944
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465273574"
     variation       945
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300694539"
     variation       946
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1233143954"
     variation       949
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:758015985"
     variation       950
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1221900230"
     variation       951
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201382539"
     variation       953
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778378455"
     variation       955
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747488243"
     variation       956
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1257475175"
     variation       957
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:920572301"
     variation       958
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566981480"
     variation       959
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201132832"
     variation       960
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1311648825"
     variation       961
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746086759"
     variation       963
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1050498490"
     variation       965
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185654445"
     variation       966..970
                     /gene="PUSL1"
                     /replace="tc"
                     /replace="tcctc"
                     /db_xref="dbSNP:758543986"
     variation       967
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775514736"
     variation       968
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199813938"
     variation       970
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1208494032"
     variation       971
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768744576"
     variation       973
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773076061"
     variation       976
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1187585078"
     variation       980
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760596195"
     variation       981
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766185058"
     variation       982
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:115163464"
     variation       983
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752423551"
     variation       985
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757927920"
     variation       986
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372351650"
     variation       987
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1311559298"
     variation       988
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202181704"
     variation       989..990
                     /gene="PUSL1"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:777917545"
     variation       989
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1011141670"
     variation       991
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757759017"
     variation       992
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368983799"
     variation       994
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200714562"
     variation       995
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140444081"
     exon            996..1343
                     /gene="PUSL1"
                     /inference="alignment:Splign:2.1.0"
     variation       996
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1182074380"
     variation       998..1033
                     /gene="PUSL1"
                     /replace="g"
                     /replace="gctgcctcctgcaccctgcaggggccacagttcggg"
                     /db_xref="dbSNP:1557625224"
     variation       1001
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1156416791"
     variation       1002
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1236718210"
     variation       1005
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381985066"
     variation       1006
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752974376"
     variation       1007
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185161193"
     variation       1011
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758339550"
     variation       1012..1018
                     /gene="PUSL1"
                     /replace=""
                     /replace="cctgcag"
                     /db_xref="dbSNP:1557625289"
     variation       1012
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777971209"
     variation       1013
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:745791371"
     variation       1016
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746598934"
     variation       1017
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:769904575"
     variation       1020
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779967837"
     variation       1023
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1398721685"
     variation       1024
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749054386"
     variation       1026
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768520100"
     variation       1027
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1380792764"
     variation       1030
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773819408"
     variation       1031
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:988600315"
     variation       1032
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1365118430"
     variation       1033
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771478270"
     variation       1035
                     /gene="PUSL1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:781001706"
     variation       1035
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149197908"
     variation       1039
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761138251"
     variation       1040
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1262156008"
     variation       1041
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200331726"
     variation       1046
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:759759366"
     variation       1047
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1243516143"
     variation       1049
                     /gene="PUSL1"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:369211336"
     variation       1053
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190901054"
     variation       1054
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:924512019"
     variation       1059
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1475794797"
     variation       1060
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765635935"
     variation       1061
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1404189648"
     variation       1066
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1471044707"
     variation       1070
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:752855117"
     variation       1071
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1388352974"
     variation       1072
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381059205"
     variation       1075
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369004218"
     variation       1076
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:558415805"
     variation       1077
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1227529585"
     variation       1078
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1282028834"
     variation       1079
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1321049056"
     variation       1080
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1054267100"
     variation       1082
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263574585"
     variation       1085
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485409777"
     variation       1086
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1203109515"
     variation       1087
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263802608"
     variation       1088
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1447441230"
     variation       1089
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198266097"
     variation       1090
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1238667941"
     variation       1093
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751733094"
     variation       1095
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1481577861"
     variation       1096
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1177375329"
     variation       1098
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379401688"
     variation       1100
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1411747914"
     variation       1101
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757447142"
     variation       1102
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:894327977"
     variation       1106
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780093090"
     variation       1108
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1386336211"
     variation       1109
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749253159"
     variation       1110
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:768269357"
     variation       1112
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778835482"
     variation       1114
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1406445186"
     variation       1116
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196206303"
     variation       1117
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192098021"
     variation       1124
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1315916674"
     variation       1125
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437882565"
     variation       1127
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045893622"
     variation       1129
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:906990960"
     variation       1130
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771795638"
     variation       1132
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772880977"
     variation       1133
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372779104"
     variation       1134
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1434663451"
     variation       1135
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1423781502"
     variation       1137
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1266911161"
     variation       1139
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1490853780"
     variation       1142
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777053548"
     variation       1145
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1476761112"
     variation       1147
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1250090624"
     variation       1149
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1458128588"
     variation       1151
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1417499467"
     variation       1152
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1161811304"
     variation       1154
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1557625716"
     variation       1155..1159
                     /gene="PUSL1"
                     /replace="ag"
                     /replace="agtag"
                     /db_xref="dbSNP:1557625722"
     variation       1159
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1364736901"
     variation       1161
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749701654"
     variation       1163
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1162199883"
     variation       1164..1166
                     /gene="PUSL1"
                     /replace=""
                     /replace="cct"
                     /db_xref="dbSNP:1466365795"
     variation       1164
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1367951431"
     variation       1165
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397568074"
     variation       1168
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1426043808"
     variation       1170
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753158378"
     variation       1171
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:536540812"
     variation       1172
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764374713"
     variation       1173
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751855297"
     variation       1175
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757357100"
     variation       1179
                     /gene="PUSL1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1245210400"
     variation       1180
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1326367080"
     variation       1182
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:964853959"
     variation       1183
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1027429064"
     variation       1184
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1361452164"
     variation       1186..1187
                     /gene="PUSL1"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1279571320"
     variation       1190
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1223342226"
     variation       1191..1193
                     /gene="PUSL1"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1232347544"
     variation       1193
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77848783"
     variation       1194
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:566617517"
     variation       1195..1199
                     /gene="PUSL1"
                     /replace="tct"
                     /replace="tctct"
                     /db_xref="dbSNP:1557625852"
     variation       1195
                     /gene="PUSL1"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:769488167"
     variation       1199
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210216414"
     variation       1202
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1479821418"
     variation       1208
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1179137599"
     variation       1209
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769145058"
     variation       1210
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195704391"
     variation       1215..1228
                     /gene="PUSL1"
                     /replace="gg"
                     /replace="gggcacagtgcagg"
                     /db_xref="dbSNP:1444422842"
     variation       1215
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1182091629"
     variation       1216
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164420408"
     variation       1217
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1030825817"
     variation       1218..1221
                     /gene="PUSL1"
                     /replace="ca"
                     /replace="caca"
                     /db_xref="dbSNP:966851043"
     variation       1221
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:978481365"
     variation       1222
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1018956388"
     variation       1223
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:925327756"
     variation       1224
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1425780972"
     variation       1226
                     /gene="PUSL1"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1557625938"
     variation       1226
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164931415"
     variation       1227..1228
                     /gene="PUSL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1398735587"
     variation       1227
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748736250"
     variation       1228
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1460184330"
     variation       1229
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1394939725"
     variation       1234
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778540920"
     variation       1235
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1396705195"
     variation       1236
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:988140254"
     variation       1237
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:540894935"
     variation       1238
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182389642"
     variation       1239
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246621828"
     variation       1241
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:968112460"
     variation       1242
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147996649"
     variation       1243..1262
                     /gene="PUSL1"
                     /replace="accaagaagagagtaccaag"
                     /replace="accaagaagagagtaccaagaagagagtaccaag"
                     /db_xref="dbSNP:374360798"
     variation       1243
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1305817724"
     variation       1244
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:906933237"
     variation       1247
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1557626029"
     variation       1248
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:558593844"
     variation       1250..1255
                     /gene="PUSL1"
                     /replace="agag"
                     /replace="agagag"
                     /replace="agagagag"
                     /db_xref="dbSNP:1254105831"
     variation       1251
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746666267"
     variation       1253
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:762313757"
     variation       1255
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:575319963"
     variation       1258
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3818448"
     variation       1261
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1186412819"
     variation       1262
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1418224486"
     variation       1266
                     /gene="PUSL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1426238747"
     variation       1267
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1180011275"
     variation       1268..1271
                     /gene="PUSL1"
                     /replace="tt"
                     /replace="tttt"
                     /db_xref="dbSNP:1171851401"
     variation       1270..1274
                     /gene="PUSL1"
                     /replace="tt"
                     /replace="ttgtt"
                     /db_xref="dbSNP:1415753595"
     variation       1275
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:141683763"
     variation       1278
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1468957278"
     variation       1280
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1334525582"
     variation       1281
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770377125"
     variation       1284
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916925191"
     variation       1285
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1347080765"
     variation       1286
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554539884"
     variation       1287
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:900800170"
     variation       1291
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763330959"
     variation       1293
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1216409542"
     variation       1294
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1296313823"
     variation       1296
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323166747"
     variation       1297
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764569099"
     variation       1298
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265428691"
     variation       1301..1302
                     /gene="PUSL1"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1462028859"
     variation       1301
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767545531"
     variation       1302
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:762194174"
     variation       1304
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556619320"
     variation       1305
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766964154"
     variation       1308
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1423718728"
     variation       1310
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:543885098"
     variation       1311
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:897606434"
     variation       1312
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1430917557"
     variation       1313
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414860055"
     variation       1314
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1330342378"
     variation       1315
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1158023735"
     variation       1317
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448463812"
     variation       1318
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377184547"
     variation       1319
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:958028263"
     variation       1320
                     /gene="PUSL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:574795982"
     variation       1321
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1217449977"
     variation       1325
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1303297885"
     variation       1328
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1314083972"
     variation       1329
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344926503"
     variation       1332
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750556219"
     variation       1333
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1285454037"
     variation       1335
                     /gene="PUSL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756177938"
     variation       1336
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1223581686"
     variation       1338
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765171413"
     variation       1339
                     /gene="PUSL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1319324441"
     variation       1340
                     /gene="PUSL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1258838640"
     variation       1341
                     /gene="PUSL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752587686"
ORIGIN      
gtccgcgcgcgcgcaggattcctgcgctggaggccgcctctgacgccaccggctgggctccgccatgagttcggcgccggcctcaggctccgtgcgcgcgcgctatcttgtgtacttccagtacgtgggcaccgactttaacggggtcgcggccgtcaggggcactcagcgcgccgtcggggtccagaactacctggaggaggccgccgagcggctgaattccgtggagccggtcaggttcaccatctccagccgcacggacgccggggtccacgccctgagcaacgcggcgcacctggacgtccagcgccgctcaggccggccgcccttcccgcccgaggtcctggccgaggccctcaacacacacctgcggcacccggccatcagggtcctgcgggccttccgagtgcccagcgacttccacgctcgtcacgcagccacgtcccggacctacctgtaccgcctggccactggctgtcaccggcgtgatgagctgccggtgtttgaacgcaacctatgctggactctcccggcagactgcctggatatggtcgccatgcaggaagccgcccagcacctcctcggcacacacgacttcagcgccttccagtccgctggcagcccggtgccgagccccgtgcgaacgctgcgccgggtctccgtttccccaggccaagccagccccttggtcacccccgaggagagcaggaagctgcggttctggaacctggagtttgagagccagtctttcctgtatagacaggtacggaggatgacggctgtgctggtgggtcacgggcggctctgggtcacaggtggctctgggtcacaggtacggaggatgacggctgtgctggtggccgtggggctgggggctttggcacctgcccaggtgaagacgattctggagagccaagatcccctgggcaagcaccagacacgtgtagccccagcccacggcttattcctcaagtcagtgctgtacgggaacctcggtgctgcctcctgcaccctgcaggggccacagttcgggagccacggatgaccctggacactcaagccaaagttaggccacaccaggcccaaccctgtgctggtcaagccagggcagtcacagctgcttggggcccacagcactgctgcctggtctccacagtagcctccctgcccgggtcccagcaccctggatgcccgtctctgtcccaggcgggatggggcacagtgcaggacacagccatgtacaccaagaagagagtaccaagtagtcttttgttcagcttttactggaaactgctgtctaggaccacctgccctaaccaggaataaaggcaagacagcctgga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]