ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-15 15:09:56, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001333444 752 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana RmlC-like cupins superfamily protein
(AT1G50590), partial mRNA.
ACCESSION NM_001333444
VERSION NM_001333444.1
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 752)
AUTHORS Theologis,A., Ecker,J.R., Palm,C.J., Federspiel,N.A., Kaul,S.,
White,O., Alonso,J., Altafi,H., Araujo,R., Bowman,C.L.,
Brooks,S.Y., Buehler,E., Chan,A., Chao,Q., Chen,H., Cheuk,R.F.,
Chin,C.W., Chung,M.K., Conn,L., Conway,A.B., Conway,A.R.,
Creasy,T.H., Dewar,K., Dunn,P., Etgu,P., Feldblyum,T.V., Feng,J.,
Fong,B., Fujii,C.Y., Gill,J.E., Goldsmith,A.D., Haas,B.,
Hansen,N.F., Hughes,B., Huizar,L., Hunter,J.L., Jenkins,J.,
Johnson-Hopson,C., Khan,S., Khaykin,E., Kim,C.J., Koo,H.L.,
Kremenetskaia,I., Kurtz,D.B., Kwan,A., Lam,B., Langin-Hooper,S.,
Lee,A., Lee,J.M., Lenz,C.A., Li,J.H., Li,Y., Lin,X., Liu,S.X.,
Liu,Z.A., Luros,J.S., Maiti,R., Marziali,A., Militscher,J.,
Miranda,M., Nguyen,M., Nierman,W.C., Osborne,B.I., Pai,G.,
Peterson,J., Pham,P.K., Rizzo,M., Rooney,T., Rowley,D., Sakano,H.,
Salzberg,S.L., Schwartz,J.R., Shinn,P., Southwick,A.M., Sun,H.,
Tallon,L.J., Tambunga,G., Toriumi,M.J., Town,C.D., Utterback,T.,
Van Aken,S., Vaysberg,M., Vysotskaia,V.S., Walker,M., Wu,D., Yu,G.,
Fraser,C.M., Venter,J.C. and Davis,R.W.
TITLE Sequence and analysis of chromosome 1 of the plant Arabidopsis
thaliana
JOURNAL Nature 408 (6814), 816-820 (2000)
PUBMED 11130712
REFERENCE 2 (bases 1 to 752)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 752)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (18-JUL-2017) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 752)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 5 (bases 1 to 752)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003070).
COMPLETENESS: incomplete on the 3' end.
FEATURES Location/Qualifiers
source 1..752
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="1"
/ecotype="Columbia"
gene 1..>752
/locus_tag="AT1G50590"
/gene_synonym="F11F12.9; F11F12_9"
/db_xref="Araport:AT1G50590"
/db_xref="GeneID:841481"
/db_xref="TAIR:AT1G50590"
CDS 42..752
/locus_tag="AT1G50590"
/gene_synonym="F11F12.9; F11F12_9"
/codon_start=1
/product="RmlC-like cupins superfamily protein"
/protein_id="NP_001322956.1"
/db_xref="Araport:AT1G50590"
/db_xref="GeneID:841481"
/db_xref="TAIR:AT1G50590"
/translation="
MLEGEILHEDCEGHKGVIREGGLQWMTAGKGIVHSEMPSSNSNGITHNKGLQLWINLSSRQKLVEPSYQEIESKDIAETEKDGVRVRVIAGEWNGVKSKICTRTPTMYLDFTLSPGSRISQPIPLHWNAFVYVLQGHGHFGDSKLQHSAAAAHHLLVLGLGGDMLEAWNGSDSGLPLRFILVAGEPIGEPMVQFGPFVMNTQEEIDETIDDFENFRNGFEKARHWKSQAASALGLF"
misc_feature <42..677
/locus_tag="AT1G50590"
/gene_synonym="F11F12.9; F11F12_9"
/note="Redox-sensitive bicupin YhaK, pirin superfamily
[General function prediction only]; Region: YhaK; COG1741"
/db_xref="CDD:441347"
ORIGIN
ttttttcttttccaaaatcaggatttgagacagtcacttacatgttagagggagagattttgcatgaagactgtgaaggacacaaaggagtaataagagaaggaggattacaatggatgactgcaggaaaaggcattgttcattctgaaatgccttcttctaattccaatggcattactcacaacaagggcttgcagctttggatcaatctctcctcaagacaaaaactagtggagccgagttatcaagagatagagagtaaagacatagcagaaacagagaaagatggtgtgagagttagagtcatagcaggagaatggaatggagttaagtcaaagatctgcacaagaacgccaacaatgtatttagacttcactctctcgccgggttctcgaatctctcaacccattccacttcactggaacgcgtttgtctatgttcttcaaggccatggtcactttggggattccaagttacaacattcagccgctgctgcgcaccacttgctggttctaggcctaggtggtgacatgttagaggcttggaacggttctgattccggtttgcctcttcggtttatccttgtggctggtgagcctataggtgaaccaatggttcagtttggtccttttgttatgaacacacaagaagagattgatgagaccattgacgactttgagaattttagaaatgggtttgaaaaagctagacattggaagtctcaagctgcttctgccttgggactgttctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]