GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-01-16 23:24:18, GGRNA.v2 : RefSeq release 203 (Nov, 2020)

LOCUS       NM_001319074            2421 bp    mRNA    linear   PRI 11-JUL-2020
DEFINITION  Homo sapiens retina and anterior neural fold homeobox 2 (RAX2),
            transcript variant 1, mRNA.
ACCESSION   NM_001319074 XM_005259662
VERSION     NM_001319074.4
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2421)
  AUTHORS   Yang P, Chiang PW, Weleber RG and Pennesi ME.
  TITLE     Autosomal Dominant Retinal Dystrophy With Electronegative Waveform
            Associated With a Novel RAX2 Mutation
  JOURNAL   JAMA Ophthalmol 133 (6), 653-661 (2015)
   PUBMED   25789692
  REMARK    GeneRIF: A frameshift heterozygous mutation in RAX2 inherited in an
            autosomal dominant fashion was associated with mixed cone and rod
            dysfunction.
REFERENCE   2  (bases 1 to 2421)
  AUTHORS   Davila S, Froeling FE, Tan A, Bonnard C, Boland GJ, Snippe H,
            Hibberd ML and Seielstad M.
  TITLE     New genetic associations detected in a host response study to
            hepatitis B vaccine
  JOURNAL   Genes Immun. 11 (3), 232-238 (2010)
   PUBMED   20237496
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   3  (bases 1 to 2421)
  AUTHORS   Vaquerizas JM, Kummerfeld SK, Teichmann SA and Luscombe NM.
  TITLE     A census of human transcription factors: function, expression and
            evolution
  JOURNAL   Nat. Rev. Genet. 10 (4), 252-263 (2009)
   PUBMED   19274049
  REMARK    Review article
REFERENCE   4  (bases 1 to 2421)
  AUTHORS   Wang QL, Chen S, Esumi N, Swain PK, Haines HS, Peng G, Melia BM,
            McIntosh I, Heckenlively JR, Jacobson SG, Stone EM, Swaroop A and
            Zack DJ.
  TITLE     QRX, a novel homeobox gene, modulates photoreceptor gene expression
  JOURNAL   Hum. Mol. Genet. 13 (10), 1025-1040 (2004)
   PUBMED   15028672
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC005777.1.
            On Oct 30, 2019 this sequence version replaced NM_001319074.3.
            
            Summary: This gene encodes a homeodomain-containing protein that
            plays a role in eye development. Mutation of this gene causes
            age-related macular degeneration type 6, an eye disorder resulting
            in accumulations of protein and lipid beneath the retinal pigment
            epithelium and within the Bruch's membrane. Defects in this gene
            can also cause cone-rod dystrophy type 11, a disease characterized
            by the initial degeneration of cone photoreceptor cells and
            resulting in loss of color vision and visual acuity, followed by
            the degeneration of rod photoreceptor cells, which progresses to
            night blindness and the loss of peripheral vision. Alternative
            splicing results in multiple transcript variants. [provided by
            RefSeq, Jan 2016].
            
            Sequence Note:.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC032512.1, BM083893.1 [ECO:0000332]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            CDS uses downstream in-frame AUG :: upstream AUG and CDS extension
                                                is not conserved
            MANE Ensembl match               :: ENST00000555633.3/
                                                ENSP00000450456.3
            RefSeq Select criteria           :: based on manual assertion,
                                                conservation, expression,
                                                longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-66                AC005777.1         8852-8917           c
            67-550              AC005777.1         8216-8699           c
            551-2421            AC005777.1         5778-7648           c
FEATURES             Location/Qualifiers
     source          1..2421
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19p13.3"
     gene            1..2421
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="retina and anterior neural fold homeobox 2"
                     /db_xref="GeneID:84839"
                     /db_xref="HGNC:HGNC:18286"
                     /db_xref="MIM:610362"
     exon            1..66
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /inference="alignment:Splign:2.1.0"
     variation       4
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150444854"
     variation       5
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370564299"
     variation       9
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:912749730"
     variation       11
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1206517243"
     variation       14
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1407741009"
     variation       16
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:886054371"
     variation       18
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959858612"
     variation       19
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:576680324"
     variation       25
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1403744575"
     variation       26
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1431138226"
     variation       26
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322471973"
     variation       35
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1234677376"
     variation       36
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372937839"
     variation       37
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1271892443"
     variation       39
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306578133"
     variation       41
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445635462"
     variation       43
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:920193014"
     variation       44
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:974261994"
     variation       45
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1299442229"
     variation       47
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464980540"
     variation       48
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:994833506"
     variation       49
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:563046576"
     variation       52..65
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gggc"
                     /replace="gggctgccgtgggc"
                     /db_xref="dbSNP:572518936"
     variation       53
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1436920396"
     variation       54
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182965071"
     variation       55
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1178230926"
     variation       58
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1440609438"
     variation       59
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252745152"
     variation       60
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1184528094"
     variation       61
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599187718"
     variation       63
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218333531"
     variation       65
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776666200"
     variation       66
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:981516220"
     exon            67..550
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /inference="alignment:Splign:2.1.0"
     variation       68
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1319597272"
     variation       69
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:920064978"
     variation       70
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1258092113"
     misc_feature    71..73
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="upstream in-frame stop codon"
     variation       72
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1043312574"
     variation       73
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1190932074"
     variation       74
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389639384"
     variation       81..86
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ag"
                     /replace="agagag"
                     /db_xref="dbSNP:1165725005"
     variation       84
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376409134"
     variation       86
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:940260322"
     variation       89
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383575685"
     variation       99
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:915547498"
     variation       100..101
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:1303407067"
     variation       100
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599187434"
     variation       105
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373673664"
     variation       106
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908579264"
     variation       107
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:938390506"
     variation       108
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1372272151"
     variation       109
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:928388538"
     variation       110..118
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="acacaca"
                     /replace="acacacaca"
                     /replace="acacacacaca"
                     /db_xref="dbSNP:1363844035"
     variation       116..120
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="acaga"
                     /db_xref="dbSNP:982970212"
     variation       117
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537771552"
     variation       118..124
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aga"
                     /replace="agaga"
                     /replace="agagaga"
                     /db_xref="dbSNP:749789280"
     variation       119
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1248680380"
     variation       121
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:568840271"
     variation       127
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:916002951"
     variation       138
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:551943306"
     variation       139
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1206759692"
     variation       142
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768499356"
     variation       143
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1247289760"
     variation       154
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1599187381"
     variation       155..161
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /replace="cccccccc"
                     /db_xref="dbSNP:34586885"
     variation       156
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1359006134"
     variation       157
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959249952"
     variation       158
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746772814"
     variation       159
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1185539982"
     variation       160..161
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:746538052"
     variation       160
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:571293854"
     variation       162..163
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1420693783"
     variation       166
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1599187357"
     variation       167
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:566513129"
     variation       168
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:546385357"
     variation       171
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1423275788"
     variation       174
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599187346"
     variation       180
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256999307"
     variation       188
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188542459"
     variation       194
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020669654"
     variation       195
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11085039"
     misc_feature    197..199
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="upstream_AUG_codon; putative N-terminal extension:
                     MPAPVEGTDFPGAGRQAWGSPALSLPVAPPAVSPPSVPLPSHQVGA"
     variation       200
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1260759596"
     variation       201
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:560887440"
     variation       202
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777577190"
     variation       203
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756144853"
     variation       204
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1599187298"
     variation       206
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1242201673"
     variation       207
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376728393"
     variation       208
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1293432590"
     variation       212
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1226302385"
     variation       219
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:890752467"
     variation       220
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151337691"
     variation       221
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:532025456"
     variation       222
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:563219308"
     variation       226
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767107072"
     variation       228
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759235922"
     variation       229
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1038489956"
     variation       230
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751293029"
     variation       235
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:894749740"
     variation       236..251
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ggg"
                     /replace="gggaggcaagcctggg"
                     /db_xref="dbSNP:1444346270"
     variation       236
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:546377680"
     variation       239
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1421323116"
     variation       242
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1192887399"
     variation       246
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777116818"
     variation       247
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764492483"
     variation       256
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761291839"
     variation       257
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1298424521"
     variation       258
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1487990073"
     variation       259
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775399271"
     variation       261
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772168769"
     variation       262
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746040305"
     variation       263
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1599187214"
     variation       273
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056084326"
     variation       274
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774569774"
     variation       278
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345907890"
     variation       279..285
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /replace="cccccccc"
                     /db_xref="dbSNP:559035106"
     variation       279
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:577371158"
     variation       280
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749078953"
     variation       281
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777683734"
     variation       283
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:755985251"
     variation       284
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:748161606"
     variation       285
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:754545211"
     variation       288
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751186938"
     variation       289
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:560596079"
     variation       290
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143887958"
     variation       296
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1374577135"
     variation       298
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196395138"
     variation       301
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754127884"
     variation       302
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115886593"
     variation       307
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1427497581"
     variation       309
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761046965"
     variation       310
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776087366"
     variation       311
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767527362"
     variation       315
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759617501"
     variation       316
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200711581"
     variation       318
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375810903"
     variation       323
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772854972"
     variation       324
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:979254481"
     variation       328
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757287837"
     variation       331
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1305855323"
     variation       334
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1444896908"
     CDS             335..889
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="retina and anterior neural fold homeobox like 1;
                     Q50-type retinal homeobox protein; retina and anterior
                     neural fold homeobox-like protein 1"
                     /codon_start=1
                     /product="retina and anterior neural fold homeobox protein
                     2"
                     /protein_id="NP_001306003.2"
                     /db_xref="GeneID:84839"
                     /db_xref="HGNC:HGNC:18286"
                     /db_xref="MIM:610362"
                     /translation="
MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA"
     misc_feature    order(416..430,434..436,485..487,503..505,542..544,
                     548..553,560..565,569..577,581..586)
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(422..424,431..433,551..553,560..565,572..574)
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    425..586
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:365835"
     variation       335
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:966492816"
     variation       337
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1329692934"
     variation       338
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1411731808"
     variation       342
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1020890733"
     variation       345
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1398468087"
     variation       346
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201416315"
     variation       348
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144065007"
     variation       349
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781275318"
     variation       352
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755028810"
     variation       353
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:556179949"
     variation       355..389
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ggggccggcaaccgagggtgggggtctggggccgg"
                     /replace="ggggccggcaaccgagggtgggggtctggggccggcaaccgagggtgg
                     gggtctggggccgg"
                     /db_xref="dbSNP:780405331"
     variation       356
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758091449"
     variation       359
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1181819192"
     variation       360
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750120142"
     variation       361
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764316452"
     variation       367
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149515429"
     variation       368
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:538785333"
     variation       370
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:898244077"
     variation       373
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599187028"
     variation       375
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768008187"
     variation       379
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139127905"
     variation       381
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:751619049"
     variation       383
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766488722"
     variation       384
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1338805354"
     variation       387
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778194719"
     variation       388
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367658021"
     variation       391
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769403788"
     variation       392
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374434635"
     variation       399
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1406715423"
     variation       403
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1568401195"
     variation       404..412
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aagaag"
                     /replace="aagaagaag"
                     /db_xref="dbSNP:756505075"
     variation       404
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:553002220"
     variation       410
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370364475"
     variation       416
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779669577"
     variation       417
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199546013"
     variation       418
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:535943685"
     variation       421
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778633054"
     variation       425
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200153795"
     variation       426
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373009969"
     variation       429
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1225721432"
     variation       433
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1187429141"
     variation       440
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781588193"
     variation       442
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755448810"
     variation       446
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056190175"
     variation       450
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752094189"
     variation       451
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766400493"
     variation       454
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1473615092"
     variation       461
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763112380"
     variation       464
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761987436"
     variation       465
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370757303"
     variation       466
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768600946"
     variation       467
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760640216"
     variation       468
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775581464"
     variation       469
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1163670829"
     variation       470
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599186870"
     variation       472
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771416905"
     variation       473
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201124970"
     variation       475
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778346457"
     variation       476
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770597544"
     variation       478
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748981950"
     variation       481
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781498623"
     variation       482
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:565566531"
     variation       484..485
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ggatgtgtacagcctg"
                     /db_xref="dbSNP:1283758565"
     variation       484
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752009578"
     variation       485..488
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ggatgtgtacagcctgtaca"
                     /replace="tacc"
                     /db_xref="dbSNP:1568401113"
     variation       486
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1374530421"
     variation       487
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1214336624"
     variation       488
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337070706"
     variation       489
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:76076446"
     variation       490
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141804618"
     variation       495
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138553345"
     variation       500
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1404557350"
     variation       503
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765285304"
     variation       504
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757454259"
     variation       506
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370195708"
     variation       509
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1085307700"
     variation       511
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:569526421"
     variation       512
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374872032"
     variation       515
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373359134"
     variation       518
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760560608"
     variation       519
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1409952719"
     variation       520
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:775483414"
     variation       526
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1188584260"
     variation       527
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1396257256"
     variation       528
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767485173"
     variation       529
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252557730"
     variation       537
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202149846"
     variation       539
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1333788576"
     variation       541
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773887682"
     variation       542
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372266287"
     variation       543
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748896187"
     variation       544
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1021707653"
     variation       545
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772852323"
     variation       548
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216053749"
     exon            551..2421
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /inference="alignment:Splign:2.1.0"
     variation       551
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775877146"
     variation       552
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772356880"
     variation       553
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1258539834"
     variation       559
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:574101760"
     variation       560
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1316964484"
     variation       565
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308593558"
     variation       566
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746321949"
     variation       567
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:398124430"
     variation       568
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1055074641"
     variation       569
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1294461966"
     variation       570
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779301810"
     variation       572
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039500182"
     variation       575
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599186133"
     variation       576
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1359067275"
     variation       577
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757897383"
     variation       581
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1407392654"
     variation       582
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749374386"
     variation       584
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148629445"
     variation       585
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:573043030"
     variation       589
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474928513"
     variation       592
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1417014277"
     variation       593
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752883776"
     variation       594
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:121908280"
     variation       595
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599186084"
     variation       602
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259459969"
     variation       609
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754730849"
     variation       610
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751453416"
     variation       612
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1262130971"
     variation       613
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:952301557"
     variation       616
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201021639"
     variation       617
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762922416"
     variation       620
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1289584353"
     variation       625
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1294479513"
     variation       627
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:573892963"
     variation       628
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191051622"
     variation       630
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445024391"
     variation       631
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1599186035"
     variation       632
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1242412901"
     variation       633
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1295224576"
     variation       637
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761417697"
     variation       638
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776155252"
     variation       640
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1324110061"
     variation       643
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1463116025"
     variation       648
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772425151"
     variation       649
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:968835887"
     variation       650
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1020556796"
     variation       651
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1371131603"
     variation       651
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1462895070"
     variation       653
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759806695"
     variation       654
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774846243"
     variation       655
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771534203"
     variation       658
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749859588"
     variation       659
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467659356"
     variation       661
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273209818"
     variation       662
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777949969"
     variation       663
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1030315829"
     variation       664..669
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ccccc"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:1230788366"
     variation       665
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1251233912"
     variation       668..754
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ccggccatgtcgctgcccctggagccctggttgggccccggaccgccg
                     gccgtgccaggcctcccccgcctcctgggcccgggcccg"
                     /db_xref="dbSNP:1568400617"
     variation       668
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770022976"
     variation       669
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781281689"
     variation       670..671
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1286946201"
     variation       670
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568400696"
     variation       674
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1002124313"
     variation       675
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1301564042"
     variation       678
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:398124431"
     variation       679
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755282511"
     variation       681
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1599185944"
     variation       683
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900588930"
     variation       684
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751304733"
     variation       685
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1184300868"
     variation       688
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1409720236"
     variation       692
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1045743925"
     variation       698
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1173290478"
     variation       699
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1427343992"
     variation       700
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1016261221"
     variation       702
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779877505"
     variation       703
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1167236192"
     variation       704
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1005347152"
     variation       706
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:888248705"
     variation       707
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:950155665"
     variation       709
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1412019106"
     variation       711..725
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="cgccggccgtgccag"
                     /db_xref="dbSNP:1342399719"
     variation       711
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537165398"
     variation       712
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929891283"
     variation       714
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1253237453"
     variation       715
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:895500531"
     variation       717..718
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1274933809"
     variation       718
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1195021627"
     variation       719
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758285438"
     variation       721
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1037108094"
     variation       722
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250490026"
     variation       726
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:937125036"
     variation       730
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:577841273"
     variation       731
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1481836442"
     variation       732
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1278560302"
     variation       734
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:941526473"
     variation       735
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:910094615"
     variation       737
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1305878885"
     variation       742..756
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gggcccgggcccggg"
                     /replace="gggcccgggcccgggcccggg"
                     /db_xref="dbSNP:549932754"
     variation       743
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:121908281"
     variation       745
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248541458"
     variation       747
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978473853"
     variation       748..750
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1328132335"
     variation       748
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1335212510"
     variation       753
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750394661"
     variation       754
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:947549671"
     variation       756
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1391061686"
     variation       757
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1431848727"
     variation       758..772
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="ctgcaagcgtccttc"
                     /db_xref="dbSNP:1568400594"
     variation       760
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1310919721"
     variation       763
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:922236026"
     variation       764
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113176673"
     variation       765
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:989493054"
     variation       766
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149918940"
     variation       772
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1468184577"
     variation       773
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:957818577"
     variation       775
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761243587"
     variation       776
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1183181146"
     variation       777..780
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ctca"
                     /db_xref="dbSNP:1256017785"
     variation       778
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1439994082"
     variation       780
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230148971"
     variation       789
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753446591"
     variation       793
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1486188826"
     variation       795
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1282782912"
     variation       798..809
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="t"
                     /replace="tcgcagatggct"
                     /db_xref="dbSNP:886041039"
     variation       798
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203569849"
     variation       799
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:923302208"
     variation       800
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280147395"
     variation       803
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1241272400"
     variation       806..807
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1449763445"
     variation       806
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1352324861"
     variation       811
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763649255"
     variation       812
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760415111"
     variation       813
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1016314982"
     variation       814
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:906473424"
     variation       821
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:534656129"
     variation       824
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1335805560"
     variation       825
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771442676"
     variation       826
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1014225698"
     variation       828
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112538462"
     variation       829
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165336895"
     variation       833
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771011757"
     variation       834
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202103390"
     variation       835
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1451579585"
     variation       838
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1388641253"
     variation       840
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1416399047"
     variation       843
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1187818180"
     variation       844
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:941485794"
     variation       848
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773857866"
     variation       854
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1239523974"
     variation       858
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1191315157"
     variation       863
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1599185610"
     variation       869
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1025462223"
     variation       872
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567006348"
     variation       878
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1285206637"
     variation       879
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1207025589"
     variation       880
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:769934766"
     variation       881
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1271231378"
     variation       886
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291600031"
     variation       896
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781395665"
     variation       897
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778410291"
     variation       898
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1285669869"
     variation       902
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1428380234"
     variation       903
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325548103"
     variation       904
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1318540795"
     variation       905..907
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1429367131"
     variation       905
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1458393430"
     variation       907
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747281291"
     variation       908
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1391595572"
     variation       910
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1160479173"
     variation       911
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:922852315"
     variation       914
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1462366807"
     variation       915
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1416590311"
     variation       916
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185206434"
     variation       917
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756545759"
     variation       918
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748592898"
     variation       920..922
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1190712383"
     variation       927
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026466064"
     variation       928
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1252389963"
     variation       934
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139146360"
     variation       935
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:989221840"
     variation       937
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:745749097"
     variation       940
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291917539"
     variation       941
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:536413590"
     variation       945
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467312373"
     variation       949
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1424440320"
     variation       959
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:112751250"
     variation       962
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1568400427"
     variation       963
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1483737658"
     variation       968
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1431974527"
     variation       976
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1255859869"
     variation       977
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886054369"
     variation       978
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1033493718"
     variation       983
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:980576702"
     variation       986
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1488585056"
     variation       993..994
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1362646101"
     variation       994
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237258627"
     variation       995
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:970979540"
     variation       997
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:905498355"
     variation       1004
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:781429367"
     variation       1008
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599185447"
     variation       1009..1018
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ccaccac"
                     /replace="ccaccaccac"
                     /db_xref="dbSNP:1308390277"
     variation       1016
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1413987028"
     variation       1018
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1042846985"
     variation       1023
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:947103494"
     variation       1026
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:866964205"
     variation       1027
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:913433357"
     variation       1029
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1053284032"
     variation       1031
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:933609200"
     variation       1033..1039
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="agaga"
                     /replace="agagaga"
                     /db_xref="dbSNP:765073500"
     variation       1034
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993823380"
     variation       1036
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:923552826"
     variation       1040
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1254402355"
     variation       1047
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:567541177"
     variation       1052
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599185405"
     variation       1058
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:897149979"
     variation       1059
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1232391378"
     variation       1062
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1177076931"
     variation       1068
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310390260"
     variation       1069
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:964698261"
     variation       1071
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:550787935"
     variation       1072
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1599185384"
     variation       1075
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1392935828"
     variation       1076
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1599185381"
     variation       1080
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150808899"
     variation       1082
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599185373"
     variation       1083
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11883056"
     variation       1084
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1449281671"
     variation       1090
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:565417258"
     variation       1091
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:551480253"
     variation       1096
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1388634597"
     variation       1097
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1599185352"
     variation       1104
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:994017656"
     variation       1105
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568400336"
     variation       1109
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1599185347"
     variation       1116..1117
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ca"
                     /db_xref="dbSNP:1041298455"
     variation       1120
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:960109331"
     variation       1128
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:528491190"
     variation       1129
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1361448002"
     variation       1133
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599185338"
     variation       1136
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1177239922"
     variation       1137
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1418917467"
     variation       1146
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1001431049"
     variation       1152
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1568400313"
     variation       1155
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:913557579"
     variation       1157
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599185323"
     variation       1159
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1378865918"
     variation       1160..1163
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1176327693"
     variation       1160
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142875968"
     variation       1162
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764972815"
     variation       1165
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:936340074"
     variation       1169
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374701207"
     variation       1182
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1421413127"
     variation       1192
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1426473530"
     variation       1198
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:905552147"
     variation       1206
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1042733352"
     variation       1207
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1199440183"
     variation       1209
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1482220318"
     variation       1210
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:926331334"
     variation       1213
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:980936242"
     variation       1214
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1011366370"
     variation       1215
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:559347055"
     variation       1221
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1025265039"
     variation       1222
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:971995911"
     variation       1228
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1053243121"
     variation       1229
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306842943"
     variation       1232
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:542961923"
     variation       1233
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016156373"
     variation       1236
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1377984760"
     variation       1237
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:573855282"
     variation       1238
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1243525279"
     variation       1246
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1005482654"
     variation       1247
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474208449"
     variation       1252
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:540904191"
     variation       1253
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:563450780"
     variation       1254
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039283695"
     variation       1257
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756898228"
     variation       1258
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:543676430"
     variation       1259
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984751573"
     variation       1263
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929269038"
     variation       1268
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771616343"
     variation       1270
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73531473"
     variation       1271
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:992623473"
     variation       1272
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1430276600"
     variation       1281
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1303799978"
     variation       1295..1299
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ct"
                     /replace="ctcct"
                     /db_xref="dbSNP:1381728838"
     variation       1304
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1421119688"
     variation       1319
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:959918734"
     variation       1320
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945630878"
     variation       1321
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:892698318"
     variation       1336
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147235958"
     variation       1341
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1568400222"
     variation       1342
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370569469"
     variation       1347
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1444989966"
     variation       1351
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1214548921"
     variation       1359..1367
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="agcagc"
                     /replace="agcagcagc"
                     /db_xref="dbSNP:926277551"
     variation       1362
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1237853883"
     variation       1366
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:753823753"
     variation       1368
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1229209654"
     variation       1370..1380
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ccgcgagcctg"
                     /db_xref="dbSNP:1176991714"
     variation       1371
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1035915540"
     variation       1372
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:980045637"
     variation       1373
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:534280724"
     variation       1374
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753371180"
     variation       1376
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1405801682"
     variation       1379
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1011252751"
     variation       1380
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1400360122"
     variation       1383..1388
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ctc"
                     /replace="ctcctc"
                     /db_xref="dbSNP:1377680439"
     variation       1390
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:891425007"
     variation       1394
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1312626875"
     variation       1398
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917743185"
     variation       1401
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764144252"
     variation       1402
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280789566"
     variation       1406
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542850364"
     variation       1413
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:961867623"
     variation       1416
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1242900798"
     variation       1417
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1342272741"
     variation       1424
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:573611356"
     variation       1425
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:997655392"
     variation       1426..1427
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1208537861"
     variation       1427
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1399881648"
     variation       1431
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:984676271"
     variation       1435
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1483346450"
     variation       1437
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1599185088"
     variation       1439
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1599185083"
     variation       1441
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760554835"
     variation       1442
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:902037235"
     variation       1443
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1469652297"
     variation       1466
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1191809118"
     variation       1468
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747650052"
     variation       1472
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1039169289"
     variation       1475
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397168431"
     variation       1479
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1401066152"
     variation       1480
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:558372260"
     variation       1483
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1385213687"
     variation       1494
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1028777617"
     variation       1508
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371486734"
     variation       1510
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1412143938"
     variation       1512
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775459770"
     variation       1513
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886054368"
     variation       1516
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:965869191"
     variation       1517
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:888032282"
     variation       1519
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:572021504"
     variation       1521
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929336441"
     variation       1523
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1279361854"
     variation       1524
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1339777439"
     variation       1525
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1197510704"
     variation       1528
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599185028"
     variation       1530
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767221990"
     variation       1535
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:992280356"
     variation       1536
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112369501"
     variation       1539
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254957896"
     variation       1543
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1010119724"
     variation       1551
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:892645756"
     variation       1556
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477435359"
     variation       1563
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778568577"
     variation       1564
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1568400098"
     variation       1565
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:928487890"
     variation       1568
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:576669713"
     variation       1569
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28673245"
     variation       1570
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1447305599"
     variation       1572
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1001154925"
     variation       1576
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1208248243"
     variation       1578
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115071988"
     variation       1579
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:949142739"
     variation       1590..1596
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gagag"
                     /replace="gagagag"
                     /db_xref="dbSNP:1326625879"
     variation       1594
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599184967"
     variation       1596..1598
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1229405773"
     variation       1596
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302183750"
     variation       1605
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1218137292"
     variation       1606
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1316593410"
     variation       1607..1609
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1467155450"
     variation       1607
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:990041035"
     variation       1609..1613
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="gccag"
                     /db_xref="dbSNP:138512126"
     variation       1609
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917547"
     variation       1611
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1031739378"
     variation       1612
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599184940"
     variation       1626
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448942088"
     variation       1631
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1322007235"
     variation       1639
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:571601214"
     variation       1640
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:901586216"
     variation       1643
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1473418462"
     variation       1645
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167665146"
     variation       1647
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419425408"
     variation       1649
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459454439"
     variation       1651
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1324612320"
     variation       1654
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599184907"
     variation       1655
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1325985778"
     variation       1657..1662
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gtc"
                     /replace="gtcgtc"
                     /db_xref="dbSNP:1315969232"
     variation       1659
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017267736"
     variation       1660
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1007689446"
     variation       1663
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1568400025"
     variation       1665
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:887917665"
     variation       1666
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:551864984"
     variation       1668
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332561160"
     variation       1672
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1232812430"
     variation       1673
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:929531306"
     variation       1674
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917546"
     variation       1677
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1203554366"
     variation       1682
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:965420416"
     variation       1683
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1486178205"
     variation       1684
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190471891"
     variation       1693
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1196540731"
     variation       1694..1697
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1163670662"
     variation       1694
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1056861754"
     variation       1695
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256086044"
     variation       1696
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:939491559"
     variation       1701
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1020082058"
     variation       1702
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1455038195"
     variation       1704
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:926699833"
     variation       1708
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1009656822"
     variation       1710
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1415213441"
     variation       1712
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143706741"
     variation       1719
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:956854433"
     variation       1722
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1414019055"
     variation       1724
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1307810901"
     variation       1725
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1032544180"
     variation       1727
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1456459740"
     variation       1729
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1237193177"
     variation       1753
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1260399047"
     variation       1755
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:917545"
     variation       1756
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:948551826"
     variation       1759
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:914387817"
     variation       1762
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148990863"
     variation       1771
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:956141720"
     variation       1775
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:924339003"
     variation       1777
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773142284"
     variation       1783
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:940480224"
     variation       1784
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:887600199"
     variation       1785
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1434048965"
     variation       1788
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298636383"
     variation       1790
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1375397350"
     variation       1791
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:10405125"
     variation       1792
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332448820"
     variation       1793..1796
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1301722451"
     variation       1793
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:921814565"
     variation       1798
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181573768"
     variation       1799
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372452808"
     variation       1806
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017319851"
     variation       1807
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748630795"
     variation       1812
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1479931544"
     variation       1814
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1193642513"
     variation       1816
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1236961921"
     variation       1817
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1007241070"
     variation       1824..1833
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="cggctggccc"
                     /db_xref="dbSNP:1332818881"
     variation       1824
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1195058130"
     variation       1825
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1397448144"
     variation       1838
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886054367"
     variation       1844
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1410443397"
     variation       1847
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1599184695"
     variation       1848
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:912603253"
     variation       1852
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1170592457"
     variation       1860
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:988214081"
     variation       1861
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:886054366"
     variation       1863
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:866962886"
     variation       1866
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:956803181"
     variation       1873
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1478922343"
     variation       1878
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1324090700"
     variation       1884
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032491752"
     variation       1885
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1395475559"
     variation       1895
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:979570262"
     variation       1906
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:969593840"
     variation       1907
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1306273569"
     variation       1908
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:543639717"
     variation       1909
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256894327"
     variation       1913
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1468504582"
     variation       1915
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1214979146"
     variation       1922
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1487944852"
     variation       1924
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:533160062"
     variation       1927
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896134547"
     variation       1929
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1426676688"
     variation       1942
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1014572912"
     variation       1943
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368356816"
     variation       1944
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442343282"
     variation       1961..1981
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="cccagatcac"
                     /replace="cccagatcactcccagatcac"
                     /db_xref="dbSNP:143816706"
     variation       1965
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1277188766"
     variation       1966
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:898071508"
     variation       1969
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1348964458"
     variation       1972..1982
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="cccagatcacc"
                     /db_xref="dbSNP:945501026"
     variation       1987
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1238911098"
     variation       1993
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1056680876"
     variation       2002
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1003963778"
     variation       2003
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:865777598"
     variation       2008
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1442389569"
     variation       2019
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:905167387"
     variation       2023
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332048126"
     variation       2027
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1045194428"
     variation       2033
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781672239"
     variation       2034
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886054365"
     variation       2035..2038
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1476139623"
     variation       2035
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:541141934"
     variation       2037
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192631064"
     variation       2038
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1860322"
     variation       2039
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1162883673"
     variation       2041
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1413091180"
     variation       2046
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1401523830"
     variation       2050
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1054691513"
     variation       2051
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1343621605"
     variation       2052
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1419530134"
     variation       2057
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934470760"
     variation       2058
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554924169"
     variation       2061
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1413407200"
     variation       2066
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1418058981"
     variation       2068
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1377751315"
     variation       2070
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382467055"
     variation       2071
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778752074"
     variation       2073
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1177835874"
     variation       2079
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472474640"
     variation       2080
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1235809993"
     variation       2083
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:965701181"
     variation       2089
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:910201278"
     variation       2091
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190171660"
     variation       2094
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886054364"
     variation       2098
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:935335961"
     variation       2099..2101
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="att"
                     /db_xref="dbSNP:1185647890"
     variation       2100..2110
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="tttttttttt"
                     /replace="ttttttttttt"
                     /replace="tttttttttttt"
                     /db_xref="dbSNP:969959848"
     variation       2101
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925325878"
     variation       2110
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:541461753"
     variation       2111
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406131291"
     variation       2114
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1023841184"
     variation       2122
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1174657273"
     variation       2125
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1377596244"
     variation       2126
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:992808097"
     variation       2128
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:951791249"
     variation       2132
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751574450"
     variation       2133
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442366753"
     variation       2139
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027862612"
     variation       2141
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1374286742"
     variation       2145
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:994076896"
     variation       2146
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756949675"
     variation       2147
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753483270"
     variation       2156
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1004477347"
     variation       2159
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1599184445"
     variation       2165
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1208421186"
     variation       2174
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:879270537"
     variation       2180
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:887452255"
     variation       2183
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1206792435"
     variation       2184
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599184427"
     variation       2189
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568399751"
     variation       2192
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:796661165"
     variation       2204
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1439336622"
     variation       2205
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1281958115"
     variation       2206
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397310167"
     variation       2207
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1450074262"
     variation       2209
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995978121"
     variation       2213
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138882802"
     variation       2215
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1420924451"
     variation       2216..2219
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1412126974"
     variation       2217
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556680562"
     variation       2222
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397971978"
     variation       2225
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1362231528"
     variation       2227
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:905221601"
     variation       2228..2230
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:533827006"
     variation       2229
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1009209788"
     variation       2231
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405019314"
     variation       2232
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:557232331"
     variation       2238
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:8103165"
     variation       2247
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537209342"
     variation       2248
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1274021560"
     variation       2249
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1339993241"
     variation       2253
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:893896630"
     variation       2255
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:6510769"
     variation       2257
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:557945632"
     variation       2279
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1457343900"
     variation       2299
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:925315867"
     variation       2300
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1043827967"
     variation       2311
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948193256"
     variation       2317
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:934501930"
     variation       2320
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373931425"
     variation       2323
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:535098347"
     variation       2324
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1166622663"
     variation       2331
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263184456"
     variation       2334
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:902992031"
     variation       2335
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040718133"
     variation       2341
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1599184327"
     variation       2345
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1164987642"
     variation       2355
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566212226"
     variation       2356
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1599184322"
     variation       2358
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1599184316"
     variation       2362
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1489443433"
     variation       2364
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:992317695"
     variation       2366
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1322664820"
     variation       2372
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886054363"
     variation       2378
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1326759579"
     variation       2379
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432848167"
     variation       2380
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1599184296"
     variation       2382
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1276277511"
     variation       2391
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:961173478"
     variation       2400..2405
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1234040876"
     variation       2403..2409
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aaa"
                     /replace="aaacaaa"
                     /db_xref="dbSNP:1450710786"
     variation       2406
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275122025"
     variation       2409
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:908101133"
     variation       2411
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1287089282"
     variation       2412
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775609621"
     variation       2414..2420
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aaa"
                     /replace="aaacaaa"
                     /db_xref="dbSNP:1449135227"
     variation       2417
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262903125"
     variation       2418..2421
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aa"
                     /replace="aaaa"
                     /db_xref="dbSNP:983670157"
ORIGIN      
agacgcagcgccaggcccgctggggcaggtgtcccgtggaaatcgacggaggggctgccgtgggcggccgtgacagtcacagagaggggaagagaaaacagggacggtgacacacacagagagaaggaagagcagacagaggcacagcaggagacccccccaagcccgaggaggacagcctggggatgcagagcgcatgccggccccagtggagggaaccgatttccccggagccgggaggcaagcctggggctcccctgccctgtccctgccggtagcccccccagccgtctccccaccatctgtcccgctgccgtcccaccaggtgggagccatgttcctgagcccgggcgaggggccggcaaccgagggtgggggtctggggccgggcgaggaggcccccaagaagaagcaccggaggaaccgcaccaccttcaccacctaccagctgcaccagctggagcgggcgttcgaggcctctcactacccggatgtgtacagccgtgaggagctggcagccaaggtgcacctacctgaggtgcgcgtgcaggtgtggttccagaaccgccgggccaagtggcgccgccaggagcggctggagtcaggctcgggtgccgtggcagctccgagactccccgaggccccagcgctgccgttcgcccgccccccggccatgtcgctgcccctggagccctggttgggccccggaccgccggccgtgccaggcctcccccgcctcctgggcccgggcccggggctgcaagcgtccttcgggcctcatgcctttgctcccaccttcgcagatggcttcgccctggaggaggcgtccctgcggctgctggccaaggaacatgcacaggctctggacagggcctggccgccagcctgagcctgccgccctcccgggccccctcctcggcccaacccgagaaccggggacgtgccctggtgacagccaccacgccttggcctaggccgaggtcatggagcaaccgtggtcaggccaggccaccaccactggggagcgggaccagagagacaggctgctgggttccctgcccccatcccgtctcccaccccatcgccacccgtcctgctggcagcggactggcccccagtgtcaggcaggaggtgacccaagtattctcaggccaggtgcggggacctcctcccctcctggggcctcagtctcctgtctgttaattgggcgtgggggcctccgaggttcgagggctgcgaggctgtgggtggcgggaccgctgactctgtaagatgagtgtaaatctctctgcttctcctaatccccatcagcagagctgcccactctccaggctcccagtcccctggaaataacaaatagcagcagctcccgcgagcctggtctcctctcaccgtgtgctcgccatgtgagcactcccctctccgttgtgccctggacctcgggcacagctgtcagcccattctatagagagggaaaccggggcttaggcaggaagccaggtccccaaagtcgcacggccaggagtggatggagctgcctttcagacccatcaccggtcctaccgtccggggcacagcgacaggttctggagagagggtgggtcccgggccaggtgctggtgggcctccaggtggaggcgggctgatgctgggtgtgtcgtcatcgtcagaccgttcctcacgtccccacagaccccaggccctgtgcatgtccccagtggaggcatggccagcatctgctctgtccaacccagccgcatcgcccaagagctctgagcaaggaggctgtcgcggggccgagaacccgctgggactggcaagcacggctggcccagtgcagcaggagggggccctgaggcatgggatgggacagtctgggccagcgccacctcccgggacagaagtgcggcaccagggcaggagctgcagtagctaccctccccgtctccagcctgggctccccagatcactcccagatcaccaggtcaccccatctctaggcggcacctcacacaccagtcctgtggtccaacgccccgccatcacccaatgtcaccgcacaccaggcagtggggacacggcagtaagcacaagaaagatttttttttttaaagctaaaccaggccaggtgcggtggctcatgcctgtaatcccagtgctttgggaggctgaggtgggaggattgcttgagaccagcctgggtgacacagcaagaccccatctccacaaacgtttttaaaatgtgccgggtgtactggtgcacacctgtcatcccagctacccaagaagctgaggcaagaggatcacttgagcccagaaggtcgaggctgcagggagctgtgatcacactgctgcactccagcctgtgcaacagagccagaccctgactcaatacaaataaaaaacaaatctaaaacaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]