GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-10 16:47:18, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001317181            7378 bp    mRNA    linear   ROD 31-MAR-2024
DEFINITION  Rattus norvegicus argonaute RISC component 1 (Ago1), transcript
            variant 1, mRNA.
ACCESSION   NM_001317181
VERSION     NM_001317181.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 7378)
  AUTHORS   Zhan,J., Hu,P. and Wang,Y.
  TITLE     lncRNA PVT1 aggravates doxorubicin-induced cardiomyocyte apoptosis
            by targeting the miR-187-3p/AGO1 axis
  JOURNAL   Mol Cell Probes 49, 101490 (2020)
   PUBMED   31786333
  REMARK    GeneRIF: lncRNA PVT1 aggravates doxorubicin-induced cardiomyocyte
            apoptosis by targeting the miR-187-3p/AGO1 axis.
REFERENCE   2  (bases 1 to 7378)
  AUTHORS   Ghosh,U. and Adhya,S.
  TITLE     Posttranscriptional regulation of cyclin D1 by ARE-binding proteins
            AUF1 and HuR in cycling myoblasts
  JOURNAL   J Biosci 43 (4), 685-691 (2018)
   PUBMED   30207314
  REMARK    GeneRIF: Knockdown (KD) of AUF1 resulted in (1) transient
            upregulation of the mRNA level as well as an advancement of
            translation onset time (TOT) from 6 to 5 h post-serum addition, (2)
            loss of miRNA loading on AGO1 and AGO2 and (3) reduction in the
            level of AGO-1 and AGO-2 bound mRNA.
REFERENCE   3  (bases 1 to 7378)
  AUTHORS   Ghosh,U. and Adhya,S.
  TITLE     Non-equivalent Roles of AGO1 and AGO2 in mRNA Turnover and
            Translation of Cyclin D1 mRNA
  JOURNAL   J Biol Chem 291 (13), 7119-7127 (2016)
   PUBMED   26846850
  REMARK    GeneRIF: AGO1 and AGO2 play non-equivalent roles of in mRNA
            turnover and translation of Ccnd1 mRNA.
REFERENCE   4  (bases 1 to 7378)
  AUTHORS   Sun,S., Ma,J., Zhang,Q., Wang,Q., Zhou,L., Bai,F., Hu,H., Chang,P.,
            Yu,J. and Gao,B.
  TITLE     Argonaute proteins in cardiac tissue contribute to the heart injury
            during viral myocarditis
  JOURNAL   Cardiovasc Pathol 25 (2), 120-126 (2016)
   PUBMED   26764146
REFERENCE   5  (bases 1 to 7378)
  AUTHORS   Eswarappa,S.M., Potdar,A.A., Koch,W.J., Fan,Y., Vasu,K.,
            Lindner,D., Willard,B., Graham,L.M., DiCorleto,P.E. and Fox,P.L.
  TITLE     Programmed translational readthrough generates antiangiogenic
            VEGF-Ax
  JOURNAL   Cell 157 (7), 1605-1618 (2014)
   PUBMED   24949972
REFERENCE   6  (bases 1 to 7378)
  AUTHORS   Chi,S.W., Zang,J.B., Mele,A. and Darnell,R.B.
  TITLE     Argonaute HITS-CLIP decodes microRNA-mRNA interaction maps
  JOURNAL   Nature 460 (7254), 479-486 (2009)
   PUBMED   19536157
REFERENCE   7  (bases 1 to 7378)
  AUTHORS   Wu,L., Fan,J. and Belasco,J.G.
  TITLE     Importance of translation and nonnucleolytic ago proteins for
            on-target RNA interference
  JOURNAL   Curr Biol 18 (17), 1327-1332 (2008)
   PUBMED   18771919
REFERENCE   8  (bases 1 to 7378)
  AUTHORS   Hock,J., Weinmann,L., Ender,C., Rudel,S., Kremmer,E., Raabe,M.,
            Urlaub,H. and Meister,G.
  TITLE     Proteomic and functional analysis of Argonaute-containing
            mRNA-protein complexes in human cells
  JOURNAL   EMBO Rep 8 (11), 1052-1060 (2007)
   PUBMED   17932509
REFERENCE   9  (bases 1 to 7378)
  AUTHORS   Meister,G., Landthaler,M., Patkaniowska,A., Dorsett,Y., Teng,G. and
            Tuschl,T.
  TITLE     Human Argonaute2 mediates RNA cleavage targeted by miRNAs and
            siRNAs
  JOURNAL   Mol Cell 15 (2), 185-197 (2004)
   PUBMED   15260970
REFERENCE   10 (bases 1 to 7378)
  AUTHORS   Beier,H. and Grimm,M.
  TITLE     Misreading of termination codons in eukaryotes by natural nonsense
            suppressor tRNAs
  JOURNAL   Nucleic Acids Res 29 (23), 4767-4782 (2001)
   PUBMED   11726686
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from JAXUCZ010000005.1 and
            FM038730.1.
            
            Summary: This gene encodes a member of the argonaute family of
            proteins, which associate with small RNAs and have important roles
            in RNA interference (RNAi) and RNA silencing. This protein binds to
            microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses
            translation of mRNAs that are complementary to them. It is also
            involved in transcriptional gene silencing (TGS) of promoter
            regions that are complementary to bound short antigene RNAs
            (agRNAs), as well as in the degradation of miRNA-bound mRNA
            targets. A recent study showed this gene to be an authentic stop
            codon readthrough target, and that its mRNA could give rise to a
            C-terminally extended isoform by use of an alternative in-frame
            translation termination codon. [provided by RefSeq, Nov 2015].
            
            Transcript Variant: This variant (1) encodes two isoforms, which
            result from the use of alternative in-frame translation termination
            codons. The shorter isoform (1) results from translation
            termination at the upstream UGA stop codon, while the longer
            isoform (1x) results from UGA stop codon readthrough to the
            downstream UAG termination codon. This RefSeq represents the
            longer, C-terminally extended isoform (1x). As the UGA stop codon
            has been reported to specify several alternative amino acids
            (tryptophan, cysteine, arginine and serine), its location in the
            longer isoform is denoted by an 'X'.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR26643299.24272.1,
                                           SRR26643288.23709.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMEA5760383,
                                           SAMEA5760386 [ECO:0006172]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            stop codon readthrough :: inferred from conservation
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-228               JAXUCZ010000005.1  144041397-144041624 c
            229-412             JAXUCZ010000005.1  144036421-144036604 c
            413-533             JAXUCZ010000005.1  144034876-144034996 c
            534-715             JAXUCZ010000005.1  144034305-144034486 c
            716-852             JAXUCZ010000005.1  144033777-144033913 c
            853-987             JAXUCZ010000005.1  144033423-144033557 c
            988-1075            JAXUCZ010000005.1  144033201-144033288 c
            1076-1223           JAXUCZ010000005.1  144032436-144032583 c
            1224-1343           JAXUCZ010000005.1  144028108-144028227 c
            1344-1466           JAXUCZ010000005.1  144027611-144027733 c
            1467-1600           JAXUCZ010000005.1  144027344-144027477 c
            1601-1785           JAXUCZ010000005.1  144021816-144022000 c
            1786-1945           JAXUCZ010000005.1  144015406-144015565 c
            1946-2036           JAXUCZ010000005.1  144015170-144015260 c
            2037-2700           FM038730.1         6-669
            2701-7378           JAXUCZ010000005.1  144006618-144011295 c
FEATURES             Location/Qualifiers
     source          1..7378
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="5"
                     /map="5q36"
     gene            1..7378
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /note="argonaute RISC component 1"
                     /db_xref="GeneID:313594"
                     /db_xref="RGD:1304619"
     exon            1..228
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     CDS             204..2891
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /note="isoform 1x is encoded by transcript variant 1;
                     protein argonaute-1; eukaryotic translation initiation
                     factor 2C, 1; argonaute 1, RISC catalytic component;
                     argonaute RISC catalytic component 1"
                     /codon_start=1
                     /transl_except=(pos:2775..2777,aa:OTHER)
                     /product="protein argonaute-1 isoform 1x"
                     /protein_id="NP_001304110.1"
                     /db_xref="GeneID:313594"
                     /db_xref="RGD:1304619"
                     /translation="
MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPPAGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLERDYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQALAKAVQVHQDTLRTMYFAXRQNAVTSLDRRKLSKPWELCHPNPEEARQRELGSDGT"
     misc_feature    303..695
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /note="N-terminal domain of argonaute; Region: ArgoN;
                     pfam16486"
                     /db_xref="CDD:465134"
     misc_feature    723..875
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /note="Argonaute linker 1 domain; Region: ArgoL1;
                     pfam08699"
                     /db_xref="CDD:462567"
     misc_feature    876..1238
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(1032..1034,1077..1079,1119..1121,1131..1133,
                     1185..1187,1206..1208,1212..1214)
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
     misc_feature    1371..2648
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /note="PIWI domain, Argonaute-like subfamily. Argonaute is
                     the central component of the RNA-induced silencing complex
                     (RISC) and related complexes. The PIWI domain is the
                     C-terminal portion of Argonaute and consists of two
                     subdomains, one of which provides the...; Region:
                     Piwi_ago-like; cd04657"
                     /db_xref="CDD:240015"
     misc_feature    order(1782..1784,1794..1796,1830..1841,1848..1850,
                     1872..1874,1881..1883,1893..1895,1905..1907)
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /note="5' RNA guide strand anchoring site [active]"
                     /db_xref="CDD:240015"
     misc_feature    order(1986..1988,1992..1994,2202..2204,2616..2618)
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /note="active site"
                     /db_xref="CDD:240015"
     exon            229..412
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            413..533
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            534..715
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            716..852
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            853..987
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            988..1075
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            1076..1223
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            1224..1343
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            1344..1466
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            1467..1600
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            1601..1785
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            1786..1945
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            1946..2036
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            2037..2231
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            2232..2366
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            2367..2468
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            2469..2668
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     exon            2669..7378
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    2775..2777
                     /gene="Ago1"
                     /gene_synonym="Eif2c1"
                     /note="upstream translation termination codon, use of
                     which results in the shorter isoform 1"
ORIGIN      
actcgggcgctagcagggggagctgctgcaggctccgcggcggcggcaacggaggctgcgggggcgacagcgcgagcggccgggcttcgggggggagccgagcccggcccgggagcccgagcagtgcaagtgcgaggtacctaggcccctcacgctggactcctcagtctcccggccgcctgtcctccgcacgggtatatgggatggaagcgggaccctcgggagcagctgcaggtgcctacctgcctcccctgcagcaggtgttccaggcccctcgccggcctggcatcggcactgtgggcaaaccgatcaagcttctggccaattactttgaggtggacattcctaagattgacgtctaccattacgaggtggacatcaagccggataagtgtcctcgcagagtcaaccgggaggtggtggagtacatggtccagcatttcaaaccgcagatctttggggatcgcaagcctgtgtacgatggaaagaagaacatttacacagttacagcactgcctattggcaatgagagggttgactttgaggtgaccatccctggggaagggaaggatagaatttttaaggtctccatcaagtggctagccatcgtgagctggcgcatgctgcatgaagccttggtcagtggccagatccctgtgcccttggagtccgtgcaagccctggatgtggccatgaggcatctggcatctatgaggtacacccctgtgggccgctccttcttctcaccgcctgagggctactaccacccgctggggggtgggcgcgaggtctggttcggctttcaccagtctgtgcgccctgccatgtggaagatgatgctcaacattgatgtctcagccactgccttctacaaagcacagccagtgattgagttcatgtgtgaggtcctggacatcaggaacatagatgaacagcccaagcccctcacggattcccagcgcgttcggtttaccaaggagataaagggcctgaaggtggaagtgacccactgtggacagatgaagaggaaataccgcgtgtgtaatgttacccgtcgccctgctagccatcagacgtttcccttgcagctggagagcggacagaccgtggagtgcaccgtggcacaatatttcaagcagaaatacaaccttcagctcaagtatcctcacctgccctgcctgcaagttgggcaagagcagaagcatacctatttgcccctcgaggtctgtaacattgtggctgggcagcggtgcattaagaagctgactgacaaccagacttcaaccatgataaaggctacagctaggtcggccccagacagacaggaggagatcagtcgcctgatgaagaacgccagctacaacttggatccctacatccaggaatttggaatcaaagtgaaggatgacatgacggaggtgacggggcgagtgctgccggcgcccatcttgcagtacggcggccggaaccgggccattgctacacccaaccaaggtgtctgggacatgcgtgggaaacagttctacaatgggattgagatcaaagtctgggccatcgcctgcttcgcaccccaaaaacaatgtcgagaagaggtgctcaagaacttcacggaccagcttcggaagatctccaaggatgcagggatgcccatccagggtcagccatgtttctgcaaatacgcacagggggcggacagcgtggagcccatgttccggcatctcaagaatacctactcaggactgcagctcattattgtcatcctgcccgggaagacgccggtgtatgctgaagtgaagcgtgttggagatacgctcttgggaatggcgacacagtgtgtgcaggtgaagaatgtggtcaagacctcacctcagactctgtccaacctctgcctcaagatcaatgtcaaactcggtggcatcaacaacatccttgtcccacaccagcgctctgctgttttccaacagccagtgatttttctgggagcagacgttacacaccccccggctggggacgggaagaaaccatctatcacagcagtggtaggcagtatggatgcacaccccagccgatactgtgccactgtgcgtgtacagcgtccacggcaggagatcattgaggacttgtcctatatggtgcgggagctgctcatccagttctacaagtccacccgattcaagcccacccgaatcatcttctaccgagatggggtccctgaaggccagctgcctcagatccttcactatgagctgcttgccattcgagatgcctgcatcaaactggaaagagactaccagcctgggatcacgtacatcgtggtacagaagcgacatcacacccgcctcttttgtgctgacaagaatgagcggattgggaagagtggtaacatcccagctgggaccactgtggacaccaacatcactcacccgtttgagtttgacttctacctgtgcagccatgcaggcatccagggcaccagccgaccatcccattattatgtcctttgggatgacaaccgtttcacagcagatgagctccagatcttgacataccagctgtgccacacttatgtacgatgcacacgttctgtctctatcccagcacctgcctactatgcccgcctggtggctttccgggcccgataccacctggtggacaaggagcatgacagtggagaggggagccacatatctgggcagagcaatgggcgagacccccaggccctggccaaagccgtgcaggttcaccaggatactctacgcaccatgtacttcgcttgaaggcagaacgctgttacctcactggacagaagaaagctttccaagccctgggagctgtgccacccaaatccagaggaagcaaggcagagggagctggggtcagatggaacataggaggccttgtttctatctacagagggggtatgagggtgggaagaggaccaccaagacagattaccagccagaaatctctgatagcaacctcatgtcctccacccctctccccatcttgtcacatccgacccccctggaccaaaaggggcattactagtgcccaccatacacacagttgtctcatgtgactcacagtgctaaagactcatgctcgacagcttgctagggtcaggtctgcagccctgtggtcaaatgctggtatgtttgggtttgatattctagatgagaaagtgggtgggaagagggaaggaatttttaggagccttaatcagaaaaggtctagatttgttgaagaaaaatgaaaacagactcagatcaatattttaggatactagatgttttcatgggttcagaatccagtttgtaggaagatttttaatgctaacggtttgggttgctccgccccagctgccacccctcccattattcctctccatgttctctacccccactcgcctctccctgacagacatccagccctagtaacacttaaggcactatggcacttagctctgaggtgacacgaccctgtcttccttccgcctgctggtgggtaaccagtgccttcccgtaagggtaatgctgcagaactgcaaccttttgtacctttctctgtgggatggggtgtgggtgggagaggaggtagggagggagggacgagctatcccaatgccagcaagcctacagccagaatgccaggtaattttcatttgaaggaatttgcttccataatcattgagcttcttaaaaaaaaaaaaaaaaaatcacaacctcagatggttaaaatccattgacatttgcactttcagacatgactagtctccgagctgctgagatgactggcccttggcctttcccctcttccctggccccacctccacccccaccccacccccaccatgccaggtctagagctactgtcctagtatttctcattcttggcttctttcccccctgatggtaaagactcttttgtttcaatatttcttaactggggtgtcttacaacagaagatcttaaggactaacataagaaaacagaaaactaaatgttatttttataccataacttgagtctattgccaaaatctgaaaatccctcccaaacctgatgactctgcatcccagaaacatggagccatcagaaggaactgtggacctgacttgtattctaacctggccaaggtggggggtggttgtctccccaaggtggggcttagcctctatcttccctctgtgcagataataccttgttgtcgagacggccttcctccacggcgctgtctgtcccgcactctgccttgtaagtgcatcttccctttttctggactggactgtcctttgactccttgactaaccgagactctagcatgtcctctggacaggctcgagaattttgctgctcccttttgcttctgtttacacaaatgaaattttcctgtttcccactagggcatgtgagtgggtagcatgggcttttctttttctacccctctcttgagatactggggttgagctgtcttgcaggactggaaaagaagtgggttctagctttgtccttgctgaccttgaagcgaggccccctctttcctcgactgttctttttttcttcctgcattattgcttgggatggggaatttgaacctctgtgtacaggttccccttctgaggagcctgagcttaggattgccctgctctggtgatgaagccatgatatttagatctagcccaggcatagaggccgctggagaaaggaaagtctgaaccctggcctatggagtcacaacctttccccaggagcccttgtacagacccaggtttgctatgcaaatagtccaggttcagttgtggctggctacattgttcagtaacttcccaacaggtagcacaaacattccttatgggaaaagcccagggctgttcagtagttcctcctgtacttcttttctgctggctacagtatggagtgccccgtgggcacaggcccagctgaagaacacaatggagggctctgggaagaggcagctcactggagagcctacattccttacacaagtgcctaaacagagtgatgccaacactccatctgccctgcccatcgccttcatagacagtctacttcctgttccgtcaccctttggggagggagctcttcgcagacagtgtgctgtcagcttgggtacatttgagggcttggattaagggcactactccagaagggtcccgtcattcaccagcatttgcagatgcccgtggggaacaggtggctgtcacaactcccagcaacaagtttttgttctttctttctttgcctcactctctccagttgggttttcagctagaatgaaaatgaagcttcagccctttggtatttatgtgccatccaagaaataaaagccagagagtgctgggcgtgatggccatgtctgtagttctgttatctcagcactaaggctgaagcaggagatttgcaagtttgggtccacctgggctgctgagtgtggccagtgtgcaccatgtagcaagaccatgtgtccatagaaaggaatgagaaaaatgacttggggaatacatcttgctgtgatgtttaaacaattctttgagatttaactactgaccctgtaggttcttctcatttaaggtggtatgaacacattaaaaacagtgtcgccaagcctcagcttgtttggatttggtttaagtggtgcattgtaccaagctctgggaggattccaacctcatcttagagctttctcctcacccccacccccactcccactgccccccatccccgtttggctttccctttcctcttttcgcctcccctggcttccttttccttctccctcttccctcagcttgcttgctggctggcctgcctgcctgtctgcctgtgtgataatgaattctctgcatggctgcaatgatcccgctgttctttggcaaggtcaggcttagctcattgactacagaagaccaaaaacctgttcctcatgcccagtggtgttagccctgggctgcactgtcctcaagcttacactaggtcggagcagcgggcctgcctaactgacaaaatcagggaggtttctggcagtcccagcacctctccattttgtggagagggtttggaaaagaggtggtgatggggagtgcagctctgagttcagcccagtgtgacccagtggttgaggtggtagtgccagcctgcagggccagcctggagctgctgttgctgggaacttatgcttggactctgactaaagtcgaacataagtaggaaactgctctaaaaatctagttctcagctgcagcatggctcctctgtggctgggcagcagtgtttttgaacagttttctttttaaccagaattctgtgaatgatgccagggacatagttttcttagctggcccatgggaagtctacaaggctgctcagacctggcatcgggcatcacaaaggaggatggaatttcttccctttcagggtggaagagtcacctctgacctagccaaaaggcagttttgggaactcatgttgggaggaaggatttcgttttatttgtttttttttttttttttttgttttttttttttgtttttttgttttgttttgttttactgggctttagataacccaggatggtagttaattatgccttccttgggcagggattatggcagggatatgcaaggcactctaatacttagccttctaagcagactgggaaagggggattctctggttttctctttctccccacttactaggacttgccttctccctgagccacgagagaggctgggttggtgctctccccttactctgctcctactgacttagaacctctggctgctgtacgatagcccaggaaagggaatggaaagaatgggctcaaaacagtaatgtgaggaaggtgattcccttccttaaaaagggaaatcagaaactctccaagaattctgtaagtaaagacaatgtgtctgaatgcactgagtcctctggtgtcatagcaataaggaaaaatgaattgacttcctgtgcacacagtccaacctgatgggtgtatgttgttgcacttagcagccatgtggtgggcacgtgtgacaactctgggtttcactttattttctaaacttcttattcctctcaagtccagcatggatggggaaatgtccctggagccccgcagctgtgtacttgtttgcatttgtttcccattgagacttgtgtttgtgtcctgctttgagctgtaccctgtcccgtccattgtgaaattatcccagcagctgtaatgtacagttcccttctcaagcaagcaacagcagcacaatcctgtgttttataaagacaacagtggcttttatttctaaagtgtggtctctggcttttttttttcctgtcacaaaataaacggtgtattaattaca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]