GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-11-27 00:22:56, GGRNA.v2 : RefSeq release 202 (Sep, 2020)

LOCUS       NM_001297698            2049 bp    mRNA    linear   PRI 25-AUG-2020
DEFINITION  Homo sapiens Nanog homeobox (NANOG), transcript variant 2, mRNA.
ACCESSION   NM_001297698 XM_005253484
VERSION     NM_001297698.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2049)
  AUTHORS   Hu F, Li C, Zheng X, Zhang H, Shen Y, Zhou L, Yang X, Han B and
            Zhang X.
  TITLE     Lung adenocarcinoma resistance to therapy with EGFRtyrosine kinase
            inhibitors is related to increased expression of cancer stem cell
            markers SOX2, OCT4 and NANOG
  JOURNAL   Oncol. Rep. 43 (2), 727-735 (2020)
   PUBMED   31894290
  REMARK    GeneRIF: Lung adenocarcinoma resistance to therapy with
            EGFRtyrosine kinase inhibitors is related to increased expression
            of cancer stem cell markers SOX2, OCT4 and NANOG.
REFERENCE   2  (bases 1 to 2049)
  AUTHORS   Wang G, Kouwaki T, Mugikura K, Okamoto M, Takaki H, Funami K, Seya
            T and Oshiumi H.
  TITLE     Cytoplasmic dsRNA induces the expression of OCT3/4 and NANOG mRNAs
            in differentiated human cells
  JOURNAL   J. Biol. Chem. 294 (50), 18969-18979 (2019)
   PUBMED   31615841
  REMARK    GeneRIF: The the expression of NANOG, SOX2, Kruppel-like factor 4
            (KLF4), and proto-oncogene c-Myc was also increased by cytoplasmic
            dsRNA.
REFERENCE   3  (bases 1 to 2049)
  AUTHORS   Liu F, Shi J, Zhang Y, Lian A, Han X, Zuo K, Liu M, Zheng T, Zou F,
            Liu X, Jin M, Mu Y, Li G, Su G and Liu J.
  TITLE     NANOG Attenuates Hair Follicle-Derived Mesenchymal Stem Cell
            Senescence by Upregulating PBX1 and Activating AKT Signaling
  JOURNAL   Oxid Med Cell Longev 2019, 4286213 (2019)
   PUBMED   31885790
  REMARK    GeneRIF: Findings show that NANOG delays HF-MSC senescence by
            upregulating PBX1 and activating AKT signaling and that a feedback
            loop likely exists between PBX1 and AKT signaling.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 2049)
  AUTHORS   Saga K, Park J, Nimura K, Kawamura N, Ishibashi A, Nonomura N and
            Kaneda Y.
  TITLE     NANOG helps cancer cells escape NK cell attack by downregulating
            ICAM1 during tumorigenesis
  JOURNAL   J. Exp. Clin. Cancer Res. 38 (1), 416 (2019)
   PUBMED   31619256
  REMARK    GeneRIF: High NANOG expression is associated with prostate cancer.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2049)
  AUTHORS   Wang D, Fu L, Wei J, Xiong Y and DuBois RN.
  TITLE     PPARdelta Mediates the Effect of Dietary Fat in Promoting
            Colorectal Cancer Metastasis
  JOURNAL   Cancer Res. 79 (17), 4480-4490 (2019)
   PUBMED   31239272
  REMARK    GeneRIF: Nanog is required for PPARD induction of the colonic
            cancer stem cells expansion and liver metastasis.
REFERENCE   6  (bases 1 to 2049)
  AUTHORS   Clark AT, Rodriguez RT, Bodnar MS, Abeyta MJ, Cedars MI, Turek PJ,
            Firpo MT and Reijo Pera RA.
  TITLE     Human STELLAR, NANOG, and GDF3 genes are expressed in pluripotent
            cells and map to chromosome 12p13, a hotspot for teratocarcinoma
  JOURNAL   Stem Cells 22 (2), 169-179 (2004)
   PUBMED   14990856
REFERENCE   7  (bases 1 to 2049)
  AUTHORS   Chambers I, Colby D, Robertson M, Nichols J, Lee S, Tweedie S and
            Smith A.
  TITLE     Functional expression cloning of Nanog, a pluripotency sustaining
            factor in embryonic stem cells
  JOURNAL   Cell 113 (5), 643-655 (2003)
   PUBMED   12787505
REFERENCE   8  (bases 1 to 2049)
  AUTHORS   Mitsui K, Tokuzawa Y, Itoh H, Segawa K, Murakami M, Takahashi K,
            Maruyama M, Maeda M and Yamanaka S.
  TITLE     The homeoprotein Nanog is required for maintenance of pluripotency
            in mouse epiblast and ES cells
  JOURNAL   Cell 113 (5), 631-642 (2003)
   PUBMED   12787504
REFERENCE   9  (bases 1 to 2049)
  AUTHORS   Cavaleri F and Scholer HR.
  TITLE     Nanog: a new recruit to the embryonic stem cell orchestra
  JOURNAL   Cell 113 (5), 551-552 (2003)
   PUBMED   12787492
  REMARK    Review article
REFERENCE   10 (bases 1 to 2049)
  AUTHORS   Constantinescu S.
  TITLE     Stemness, fusion and renewal of hematopoietic and embryonic stem
            cells
  JOURNAL   J. Cell. Mol. Med. 7 (2), 103-112 (2003)
   PUBMED   12927049
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DC425336.1, AY578089.1,
            AC006517.46 and AI656990.1.
            On May 31, 2019 this sequence version replaced NM_001297698.1.
            
            Summary: The protein encoded by this gene is a DNA binding homeobox
            transcription factor involved in embryonic stem (ES) cell
            proliferation, renewal, and pluripotency. The encoded protein can
            block ES cell differentiation and can also autorepress its own
            expression in differentiating cells. Two transcript variants
            encoding different isoforms have been found for this gene.
            [provided by RefSeq, Sep 2015].
            
            Transcript Variant: This variant (2) uses an alternate in-frame
            splice site in the 3' coding region compared to variant 1. The
            encoded isoform (2) is shorter than isoform 1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY578089.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1968968 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-213               DC425336.1         8-220
            214-1083            AY578089.1         1-870
            1084-2022           AC006517.46        69693-70631         c
            2023-2049           AI656990.1         1-27                c
FEATURES             Location/Qualifiers
     source          1..2049
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12p13.31"
     gene            1..2049
                     /gene="NANOG"
                     /note="Nanog homeobox"
                     /db_xref="GeneID:79923"
                     /db_xref="HGNC:HGNC:20857"
                     /db_xref="MIM:607937"
     exon            1..364
                     /gene="NANOG"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:745333587"
     variation       2
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1416602232"
     variation       16
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1374175297"
     variation       19
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:940238720"
     variation       20
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1229018609"
     variation       22
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275510767"
     variation       28
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1037264717"
     variation       37
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150329406"
     variation       41
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1592115806"
     variation       46
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:933603341"
     variation       53
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1269654081"
     variation       55
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:137856893"
     variation       56
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749126222"
     variation       61
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1342305751"
     variation       67
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:891602729"
     variation       75
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1010121825"
     variation       77
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1024141934"
     variation       84
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759310871"
     variation       85
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1451920434"
     variation       90
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1592115829"
     misc_feature    94..96
                     /gene="NANOG"
                     /note="upstream in-frame stop codon"
     variation       98
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1565475622"
     variation       100..103
                     /gene="NANOG"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1450713632"
     variation       114
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354098207"
     variation       116
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1312854609"
     variation       118
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:774698985"
     variation       125
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:970705470"
     variation       126
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1430448555"
     variation       128
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:982076197"
     variation       129..135
                     /gene="NANOG"
                     /replace="c"
                     /replace="catcttc"
                     /db_xref="dbSNP:1168453218"
     variation       129
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149459976"
     variation       131
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959709207"
     variation       135
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1182221029"
     variation       139
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:879028526"
     variation       146
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1255282126"
     variation       151
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1187092099"
     variation       152
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763180063"
     variation       153
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1483357106"
     variation       154
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:773191662"
     variation       159
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751653454"
     variation       161
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1201832748"
     variation       162
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1390928477"
     variation       165
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375185896"
     variation       170
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201306414"
     variation       174..175
                     /gene="NANOG"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:755393650"
     variation       176
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1215440348"
     variation       177
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781490739"
     variation       185
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:753107248"
     variation       186
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756427381"
     variation       189
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263493979"
     variation       192
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1421676870"
     variation       193
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369467702"
     variation       194
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749497246"
     variation       196
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1475839526"
     variation       198
                     /gene="NANOG"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:781392509"
     variation       201
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1410601759"
     variation       203
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771174591"
     variation       207
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1453551189"
     variation       208
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167930045"
     variation       209
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1289798301"
     variation       210..215
                     /gene="NANOG"
                     /replace="t"
                     /replace="taacat"
                     /db_xref="dbSNP:748734075"
     CDS             214..1083
                     /gene="NANOG"
                     /note="isoform 2 is encoded by transcript variant 2;
                     homeobox protein NANOG; homeobox transcription factor
                     Nanog; homeobox transcription factor Nanog-delta 48"
                     /codon_start=1
                     /product="homeobox protein NANOG isoform 2"
                     /protein_id="NP_001284627.1"
                     /db_xref="CCDS:CCDS73436.1"
                     /db_xref="GeneID:79923"
                     /db_xref="HGNC:HGNC:20857"
                     /db_xref="MIM:607937"
                     /translation="
MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNMQPEDV"
     misc_feature    496..666
                     /gene="NANOG"
                     /note="Homeodomain; Region: HOX; smart00389"
                     /db_xref="CDD:197696"
     misc_feature    order(502..513,517..519,568..570,586..588,625..627,
                     631..636,643..648,652..660,664..669)
                     /gene="NANOG"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(505..507,514..516,634..636,643..648,655..657)
                     /gene="NANOG"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     variation       214
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779165176"
     variation       215
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1394440555"
     variation       218
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142192505"
     variation       219
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775286655"
     variation       220
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373057005"
     variation       222
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286421884"
     variation       226
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328385821"
     variation       228..229
                     /gene="NANOG"
                     /replace="ag"
                     /replace="agattgtccccaaag"
                     /db_xref="dbSNP:770237523"
     variation       228
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1239575136"
     variation       229
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1436456559"
     variation       230
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768420737"
     variation       231
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1482074736"
     variation       232
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776308724"
     variation       234
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761487798"
     variation       235..238
                     /gene="NANOG"
                     /replace="c"
                     /replace="cccc"
                     /db_xref="dbSNP:778297844"
     variation       235
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1415336014"
     variation       236
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1257633213"
     variation       237
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1592115935"
     variation       238..239
                     /gene="NANOG"
                     /replace=""
                     /replace="gtatcattaaa"
                     /db_xref="dbSNP:1486396745"
     variation       242..252
                     /gene="NANOG"
                     /replace=""
                     /replace="gcttgccttgc"
                     /db_xref="dbSNP:1179353699"
     variation       242
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764825768"
     variation       243
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749958450"
     variation       247
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1160290751"
     variation       248
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762299945"
     variation       252
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464750783"
     variation       257
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:768133641"
     variation       260
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2889552"
     variation       262
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:753129098"
     variation       264
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377465904"
     variation       265
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778249718"
     variation       266
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1592115956"
     variation       267
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1391832862"
     variation       269
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779211948"
     variation       272
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142142006"
     variation       274
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1232214655"
     variation       276
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280654338"
     variation       278
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:758397098"
     variation       279
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144872761"
     variation       283
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746893318"
     variation       284
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768544167"
     variation       286
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776436598"
     variation       287
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138784058"
     variation       288
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1178242158"
     variation       290
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1340692462"
     variation       291..301
                     /gene="NANOG"
                     /replace="tgtg"
                     /replace="tgtgatttgtg"
                     /db_xref="dbSNP:1466876440"
     variation       294
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1272883396"
     variation       299..310
                     /gene="NANOG"
                     /replace="g"
                     /replace="gtgggcctgaag"
                     /db_xref="dbSNP:1253250874"
     variation       299
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772732334"
     variation       303
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1049847656"
     variation       305
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1213595829"
     variation       307
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1331826065"
     variation       313
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1193387231"
     variation       315
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762579324"
     variation       316
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436745352"
     variation       327
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1565475785"
     variation       328
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:140243232"
     variation       332
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776103820"
     variation       333
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761294996"
     variation       335
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:562244854"
     variation       346
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1438911722"
     variation       348
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371254743"
     variation       352
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112366619"
     variation       353
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1303864231"
     variation       354
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761530595"
     variation       356
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765555487"
     variation       357
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2377097"
     variation       358
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1307614327"
     variation       359
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1475809728"
     variation       362
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758548769"
     exon            365..627
                     /gene="NANOG"
                     /inference="alignment:Splign:2.1.0"
     variation       366
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762319112"
     variation       368..373
                     /gene="NANOG"
                     /replace="ctc"
                     /replace="ctcctc"
                     /db_xref="dbSNP:768611065"
     variation       369
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:901986788"
     variation       370
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765490703"
     variation       371
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:71445169"
     variation       372
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:758574458"
     variation       375
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1163423317"
     variation       376
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766569539"
     variation       377..380
                     /gene="NANOG"
                     /replace="c"
                     /replace="cttc"
                     /db_xref="dbSNP:1446089215"
     variation       377..378
                     /gene="NANOG"
                     /replace="ct"
                     /replace="tc"
                     /db_xref="dbSNP:386760025"
     variation       377
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761756029"
     variation       378
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4294629"
     variation       380
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1317369332"
     variation       382
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781160817"
     variation       385
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432384081"
     variation       390
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752606802"
     variation       394
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755941262"
     variation       397
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1233329365"
     variation       398
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230236692"
     variation       406
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357634751"
     variation       407
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1294490016"
     variation       410
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201427723"
     variation       411
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749061291"
     variation       414
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1283915314"
     variation       421
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770503113"
     variation       425
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199844601"
     variation       427
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778623133"
     variation       428
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1281166356"
     variation       429
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1439953616"
     variation       432
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1465537408"
     variation       433
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323708588"
     variation       434
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1426137899"
     variation       442
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:745429944"
     variation       443
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1188732894"
     variation       446
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:771687755"
     variation       448
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:777320377"
     variation       452
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762443746"
     variation       453
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770289302"
     variation       455..460
                     /gene="NANOG"
                     /replace="aga"
                     /replace="agaaga"
                     /db_xref="dbSNP:776321505"
     variation       459
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2889551"
     variation       460
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:763314582"
     variation       461..467
                     /gene="NANOG"
                     /replace=""
                     /replace="gtgtcgc"
                     /db_xref="dbSNP:1194261907"
     variation       461
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1414927275"
     variation       462..463
                     /gene="NANOG"
                     /replace=""
                     /replace="cgc"
                     /db_xref="dbSNP:761618842"
     variation       463
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766573037"
     variation       464
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751764226"
     variation       465
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759658381"
     variation       466
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767551668"
     variation       468..473
                     /gene="NANOG"
                     /replace="aaaaaa"
                     /replace="aaaaaaaaaaaaa"
                     /db_xref="dbSNP:1476948303"
     variation       475
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752731822"
     variation       478
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756026216"
     variation       480
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777708163"
     variation       483
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367909941"
     variation       486
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757061986"
     variation       489
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4354764"
     variation       494
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:533764901"
     variation       499
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1436030818"
     variation       500
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375983497"
     variation       511
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1233354390"
     variation       514
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1471066954"
     variation       517
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1189232311"
     variation       519
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:771808289"
     variation       524..530
                     /gene="NANOG"
                     /replace="cca"
                     /replace="ccaccca"
                     /db_xref="dbSNP:1434876631"
     variation       525
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779730729"
     variation       527
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746458202"
     variation       528
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145906125"
     variation       533..539
                     /gene="NANOG"
                     /replace="tgtgt"
                     /replace="tgtgtgt"
                     /db_xref="dbSNP:1291264622"
     variation       536
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1456382970"
     variation       538
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:956441606"
     variation       541
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1286094374"
     variation       543
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1565476969"
     variation       544
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:773769124"
     variation       545
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763289367"
     variation       547
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1444900069"
     variation       549
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771307273"
     variation       556
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1370550127"
     variation       566
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370774570"
     variation       569
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1592117572"
     variation       570
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1372581437"
     variation       572
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1305758366"
     variation       576
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4438116"
     variation       577
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1592117579"
     variation       583
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373700728"
     variation       584
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:752788796"
     variation       588
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1439484312"
     variation       593
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1440962673"
     variation       595
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760741283"
     variation       597
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764081129"
     variation       598
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753791059"
     variation       599
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757041795"
     variation       600
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1347311750"
     variation       601
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1195157698"
     variation       606
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:947838760"
     variation       607
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1157451954"
     variation       619
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1400615631"
     variation       620
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1426534626"
     exon            628..714
                     /gene="NANOG"
                     /inference="alignment:Splign:2.1.0"
     variation       648
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775613887"
     variation       652
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:747285286"
     variation       659
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1335389893"
     variation       661
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1234914009"
     variation       663
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1258678831"
     variation       663
                     /gene="NANOG"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1210490466"
     variation       664
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1592118179"
     variation       684
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1425091000"
     variation       689
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:545520952"
     variation       690
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142963939"
     variation       693
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761729835"
     variation       696
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765329253"
     variation       698
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1449826028"
     variation       701
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762895266"
     variation       703
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766250001"
     variation       707
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1386308883"
     variation       710
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751276167"
     variation       711
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759258513"
     exon            715..2049
                     /gene="NANOG"
                     /inference="alignment:Splign:2.1.0"
     variation       717
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354268064"
     variation       719
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1201812157"
     variation       722
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199733579"
     variation       723
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1480556810"
     variation       726..742
                     /gene="NANOG"
                     /replace="gaacc"
                     /replace="gaacccgactgggaacc"
                     /db_xref="dbSNP:1196762983"
     variation       726
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1335835069"
     variation       731
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770105434"
     variation       732
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150847430"
     variation       733
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:770908302"
     variation       735
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774152838"
     variation       738
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164650565"
     variation       741
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:139890744"
     variation       747..748
                     /gene="NANOG"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1179773540"
     variation       748
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771742032"
     variation       749
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:775225800"
     variation       753
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760342795"
     variation       757
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763676731"
     variation       758
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1259303951"
     variation       759
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776121705"
     variation       764
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1163198673"
     variation       765
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1439849061"
     variation       768
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1326225752"
     variation       771
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1369284174"
     variation       777
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1424031960"
     variation       778
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1482876293"
     variation       779..821
                     /gene="NANOG"
                     /replace="cctggagcaacca"
                     /replace="cctggagcaaccagacccagaacatccagtcctggagcaacca"
                     /db_xref="dbSNP:755166422"
     variation       779
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761973704"
     variation       780
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:985138580"
     variation       787
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766964000"
     variation       790
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:771976703"
     variation       793
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1592118368"
     variation       794
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755415238"
     variation       795
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1467455883"
     variation       801
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350748546"
     variation       825
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1213447876"
     variation       833
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767808547"
     variation       839
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753065279"
     variation       846
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1226153770"
     variation       847
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1184870309"
     variation       852
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1592118390"
     variation       855
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1418827997"
     variation       860
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1429076311"
     variation       861
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1170193436"
     variation       862
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1348517733"
     variation       863
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323464331"
     variation       865
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1172778870"
     variation       869
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:935829547"
     variation       874
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1460790774"
     variation       882
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165296862"
     variation       885..892
                     /gene="NANOG"
                     /replace="ct"
                     /replace="ctataact"
                     /db_xref="dbSNP:1157097048"
     variation       887
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1351274995"
     variation       901
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1472318719"
     variation       911
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430197450"
     variation       914
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1193143507"
     variation       919
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1428161275"
     variation       920
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113871482"
     variation       924
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:4012938"
     variation       931
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1306599242"
     variation       935
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1401285924"
     variation       937
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746397685"
     variation       939
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333328164"
     variation       944
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1054340044"
     variation       949
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1233062096"
     variation       955
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757270967"
     variation       958
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1323754952"
     variation       961
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1206222798"
     variation       963
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4012937"
     variation       967
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201280008"
     variation       973
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1486261932"
     variation       974
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771996074"
     variation       983
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775275521"
     variation       991
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746737861"
     variation       993
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188424548"
     variation       994
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:768361524"
     variation       997
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776249604"
     variation       1004
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1432082622"
     variation       1005
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775950504"
     variation       1006
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764617267"
     variation       1008
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1391412144"
     variation       1009
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772741569"
     variation       1018
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:759987004"
     variation       1019
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1310469284"
     variation       1026
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406938077"
     variation       1027
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768082010"
     variation       1034
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753118655"
     variation       1039
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1413047331"
     variation       1043
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1422757990"
     variation       1044..1045
                     /gene="NANOG"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:781438573"
     variation       1047
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:756544552"
     variation       1049
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764470761"
     variation       1050
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1283892798"
     variation       1052
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1190453186"
     variation       1057
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1449867830"
     variation       1059
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1249767901"
     variation       1062
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199634799"
     variation       1064
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1218907568"
     variation       1066
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256149763"
     variation       1068
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211761410"
     variation       1072
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1278228972"
     variation       1073
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1310126333"
     variation       1075
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757399083"
     variation       1077
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778880176"
     variation       1078..1082
                     /gene="NANOG"
                     /replace="gtg"
                     /replace="gtgtg"
                     /db_xref="dbSNP:762642172"
     variation       1078
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:745903026"
     variation       1082
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779961242"
     variation       1083..1084
                     /gene="NANOG"
                     /replace=""
                     /replace="aa"
                     /db_xref="dbSNP:756430902"
     variation       1087..1093
                     /gene="NANOG"
                     /replace="tga"
                     /replace="tgagtga"
                     /db_xref="dbSNP:772835888"
     variation       1090
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201891299"
     variation       1092
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780859238"
     variation       1093
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:747790418"
     variation       1096
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769443721"
     variation       1097
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201553541"
     variation       1098
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772613714"
     variation       1099
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762460819"
     variation       1101
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199508627"
     variation       1102
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776129390"
     variation       1104
                     /gene="NANOG"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:765920547"
     variation       1104
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1448836627"
     variation       1105
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780510699"
     variation       1106
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1377959609"
     variation       1108
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1242537103"
     variation       1109
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750397932"
     variation       1111
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199701391"
     variation       1117
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1201096730"
     variation       1118
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754180563"
     variation       1119
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1435941475"
     variation       1121
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1167200371"
     variation       1122
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761954580"
     variation       1125
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765430743"
     variation       1127
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373028730"
     variation       1129
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758457184"
     variation       1133
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:780012561"
     variation       1135
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751463324"
     variation       1141..1153
                     /gene="NANOG"
                     /replace="ctccc"
                     /replace="ctcccctcctccc"
                     /db_xref="dbSNP:1387483293"
     variation       1143
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322969088"
     variation       1144
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1315459653"
     variation       1145
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1394320736"
     variation       1146
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1329617873"
     variation       1149
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1402027088"
     variation       1150
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1279269256"
     variation       1151
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1317607683"
     variation       1152
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1378534641"
     variation       1157
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1592118621"
     variation       1160
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765048510"
     variation       1161..1163
                     /gene="NANOG"
                     /replace="a"
                     /replace="ata"
                     /db_xref="dbSNP:1411984817"
     variation       1161
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372148495"
     variation       1163
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306010783"
     variation       1166
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:780039465"
     variation       1167..1171
                     /gene="NANOG"
                     /replace="ttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1368945565"
     variation       1170
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1267818288"
     variation       1177
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1421481609"
     variation       1180
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868488677"
     variation       1182
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1357671017"
     variation       1185
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1182445516"
     variation       1187
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1208770007"
     variation       1189
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1592118647"
     variation       1196
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1592118650"
     variation       1201
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1287101645"
     variation       1202
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758248701"
     variation       1205
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1204818643"
     variation       1208
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1489027737"
     variation       1210
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769060718"
     variation       1216
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1592118656"
     variation       1222
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1592118659"
     variation       1225
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779279550"
     variation       1227..1228
                     /gene="NANOG"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1289114378"
     variation       1233
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1592118663"
     variation       1234
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230440510"
     variation       1235
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1348805827"
     variation       1236
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1262206493"
     variation       1237
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1476683318"
     variation       1240
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1295204541"
     variation       1242
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1456388716"
     variation       1247
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1348761647"
     variation       1249
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1189342507"
     variation       1250..1258
                     /gene="NANOG"
                     /replace="ctaatcagc"
                     /replace="ctaatcagctaatcagc"
                     /db_xref="dbSNP:1565477984"
     variation       1257
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757494237"
     variation       1258
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1457316303"
     variation       1259
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1290277492"
     variation       1260
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1162762451"
     variation       1262
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1592118687"
     variation       1263..1269
                     /gene="NANOG"
                     /replace="ttt"
                     /replace="tttcttt"
                     /db_xref="dbSNP:1363749508"
     variation       1264..1268
                     /gene="NANOG"
                     /replace="tt"
                     /replace="ttctt"
                     /db_xref="dbSNP:1208547599"
     variation       1266
                     /gene="NANOG"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:371533746"
     variation       1266
                     /gene="NANOG"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1488470876"
     variation       1266
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1019148927"
     variation       1267..1281
                     /gene="NANOG"
                     /replace="tttttttttt"
                     /replace="ttttttttttt"
                     /replace="tttttttttttt"
                     /replace="ttttttttttttt"
                     /replace="tttttttttttttt"
                     /replace="ttttttttttttttt"
                     /replace="tttttttttttttttt"
                     /replace="ttttttttttttttttt"
                     /db_xref="dbSNP:rs112437708"
     variation       1270
                     /gene="NANOG"
                     /replace="t"
                     /replace="tct"
                     /db_xref="dbSNP:1592118707"
     variation       1281
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1421760371"
     variation       1282
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1298970859"
     variation       1283
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1565478009"
     variation       1285
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:965803820"
     variation       1288
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1398615671"
     variation       1289
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1315241144"
     variation       1290
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1341639129"
     variation       1291
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220227016"
     variation       1292
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1592118728"
     variation       1296
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1385817781"
     variation       1300
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1592118734"
     variation       1306
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1592118736"
     variation       1307
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:974843850"
     variation       1308..1309
                     /gene="NANOG"
                     /replace=""
                     /replace="ctt"
                     /db_xref="dbSNP:1379714872"
     variation       1308
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1267659338"
     variation       1309..1327
                     /gene="NANOG"
                     /replace="ttttttttt"
                     /replace="ttttttttttt"
                     /replace="ttttttttttttt"
                     /replace="tttttttttttttt"
                     /replace="ttttttttttttttt"
                     /replace="tttttttttttttttt"
                     /replace="ttttttttttttttttt"
                     /replace="tttttttttttttttttt"
                     /replace="ttttttttttttttttttt"
                     /replace="tttttttttttttttttttt"
                     /replace="ttttttttttttttttttttt"
                     /replace="tttttttttttttttttttttt"
                     /replace="ttttttttttttttttttttttt"
                     /replace="tttttttttttttttttttttttt"
                     /db_xref="dbSNP:rs878931413"
     variation       1309
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1317084771"
     variation       1310
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1281951986"
     variation       1311
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1355140604"
     variation       1312..1313
                     /gene="NANOG"
                     /replace="tt"
                     /replace="ttctt"
                     /db_xref="dbSNP:1170451482"
     variation       1312
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1216899570"
     variation       1315
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1434430344"
     variation       1319..1328
                     /gene="NANOG"
                     /replace=""
                     /replace="tttttttttg"
                     /db_xref="dbSNP:1565478038"
     variation       1322
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1592118766"
     variation       1324..1328
                     /gene="NANOG"
                     /replace=""
                     /replace="ttttg"
                     /db_xref="dbSNP:1284938270"
     variation       1327
                     /gene="NANOG"
                     /replace="t"
                     /replace="ttgt"
                     /db_xref="dbSNP:1391231821"
     variation       1328..1329
                     /gene="NANOG"
                     /replace=""
                     /replace="ga"
                     /db_xref="dbSNP:1487100940"
     variation       1328
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:921629569"
     variation       1329
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1256534552"
     variation       1330
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3865023"
     variation       1332
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1247467005"
     variation       1338
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1188277289"
     variation       1340
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185243982"
     variation       1341
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1592118780"
     variation       1342
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254256338"
     variation       1343
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1346861346"
     variation       1346
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1383478993"
     variation       1348
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1230497910"
     variation       1349
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1441689085"
     variation       1353
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1244798046"
     variation       1357
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1341758108"
     variation       1359
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1592118793"
     variation       1360
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:930281990"
     variation       1361
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1331778251"
     variation       1362
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1159326336"
     variation       1363
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:865950157"
     variation       1365
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1451872935"
     variation       1366
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428246118"
     variation       1368
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1304980603"
     variation       1370
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1164343159"
     variation       1371
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376103168"
     variation       1372
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868031238"
     variation       1373
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1042403321"
     variation       1378
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772212390"
     variation       1379
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1481955596"
     variation       1391
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1272133974"
     variation       1395
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332701771"
     variation       1396
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357846766"
     variation       1397
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2008442"
     variation       1401
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1232277207"
     variation       1402
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3892960"
     variation       1403
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1289867150"
     variation       1404
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1307858668"
     variation       1405
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1424384594"
     variation       1407
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1354323777"
     variation       1410
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1351116421"
     variation       1411
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:745892508"
     variation       1413
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1256372361"
     variation       1416
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1388642958"
     variation       1422
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1482773592"
     variation       1424
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1198503187"
     variation       1431
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414383913"
     variation       1432
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1592118841"
     variation       1434
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756684615"
     variation       1435
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771320663"
     variation       1438
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1222179815"
     variation       1440
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1287668872"
     variation       1441
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1458135953"
     variation       1442
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1329240621"
     variation       1443
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1269560309"
     variation       1445
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1179386887"
     variation       1453
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373044697"
     variation       1454
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275849968"
     variation       1455
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1379722740"
     variation       1456
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325835464"
     variation       1458
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1417594440"
     variation       1459
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1178427265"
     variation       1462
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1157214114"
     variation       1464
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1400387177"
     variation       1465
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1378590106"
     variation       1467
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465907099"
     variation       1470
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1335137130"
     variation       1471
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1403138901"
     variation       1472
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:906503119"
     variation       1474..1478
                     /gene="NANOG"
                     /replace="ta"
                     /replace="taata"
                     /db_xref="dbSNP:1464943290"
     variation       1478
                     /gene="NANOG"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1448142193"
     variation       1478
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1213169810"
     variation       1479..1482
                     /gene="NANOG"
                     /replace="ttt"
                     /replace="tttt"
                     /db_xref="dbSNP:1315912028"
     variation       1479
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1278934592"
     variation       1481
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1221229338"
     variation       1483
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1343330581"
     variation       1485
                     /gene="NANOG"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1330131681"
     variation       1485
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1592118880"
     variation       1490
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436553674"
     variation       1495..1503
                     /gene="NANOG"
                     /replace="g"
                     /replace="gagacgggg"
                     /db_xref="dbSNP:1370453926"
     variation       1499
                     /gene="NANOG"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1318680513"
     variation       1499
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1388164557"
     variation       1500..1503
                     /gene="NANOG"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1003633919"
     variation       1500
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61937162"
     variation       1501
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1415896970"
     variation       1502
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1317645188"
     variation       1510..1514
                     /gene="NANOG"
                     /replace="tgt"
                     /replace="tgtgt"
                     /db_xref="dbSNP:1311242625"
     variation       1510
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230841921"
     variation       1511
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1259722758"
     variation       1515
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1318536838"
     variation       1520..1523
                     /gene="NANOG"
                     /replace="agga"
                     /replace="aggagga"
                     /db_xref="dbSNP:1033730650"
     variation       1520
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211872348"
     variation       1524
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:895348473"
     variation       1525
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1592118912"
     variation       1530
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1280123717"
     variation       1531
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1324938947"
     variation       1531
                     /gene="NANOG"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1565478224"
     variation       1532
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344879455"
     variation       1534
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:749708311"
     variation       1537
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1592118921"
     variation       1538
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379994954"
     variation       1539
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1197894403"
     variation       1544
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237650115"
     variation       1547
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1592118932"
     variation       1551
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1373360646"
     variation       1552
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:28538179"
     variation       1553
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192981542"
     variation       1555
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1268403107"
     variation       1556
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432790455"
     variation       1560
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1174786437"
     variation       1561
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1427395328"
     variation       1563
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1413978887"
     variation       1569
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1426167093"
     variation       1572
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1466605494"
     variation       1573
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1170516030"
     variation       1574
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1353254195"
     variation       1578
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459051521"
     variation       1581..1583
                     /gene="NANOG"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:760621227"
     variation       1585
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204503554"
     variation       1586
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1322400736"
     variation       1590
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1314988645"
     variation       1591
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1231661064"
     variation       1599
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1366524094"
     variation       1600
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:61937163"
     variation       1601
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1279898810"
     variation       1602
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461460671"
     variation       1606
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1349939383"
     variation       1609
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1005718881"
     variation       1613..1616
                     /gene="NANOG"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1217954436"
     variation       1622
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1459445674"
     variation       1627
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1416622612"
     variation       1630
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1256146985"
     variation       1636
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:867194884"
     variation       1637..1639
                     /gene="NANOG"
                     /replace="tgc"
                     /replace="tgctaaggacaacattgatagatgc"
                     /db_xref="dbSNP:1565478286"
     variation       1637..1638
                     /gene="NANOG"
                     /replace=""
                     /replace="aaggacaacattgatagaa"
                     /db_xref="dbSNP:1555112215"
     variation       1637
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:867632119"
     variation       1638..1639
                     /gene="NANOG"
                     /replace="gc"
                     /replace="gctaaggacaacattgataagaagc"
                     /replace="gctaaggacaacattgatagaagc"
                     /replace="gctaaggtcaacattgatagaagc"
                     /db_xref="dbSNP:202064081"
     variation       1639..1640
                     /gene="NANOG"
                     /replace=""
                     /replace="taagga"
                     /db_xref="dbSNP:1223919634"
     variation       1640
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759889146"
     variation       1641
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1489120887"
     variation       1641
                     /gene="NANOG"
                     /replace="g"
                     /replace="ggcttctatcaatgttgtccttag"
                     /db_xref="dbSNP:1350031653"
     variation       1651
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183561928"
     variation       1656
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1211827266"
     variation       1658..1675
                     /gene="NANOG"
                     /replace="agt"
                     /replace="agtagatctaatactagt"
                     /db_xref="dbSNP:1334277611"
     variation       1660
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:961663922"
     variation       1664
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:973373387"
     variation       1665
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1337281525"
     variation       1670
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1488291807"
     variation       1672
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371159545"
     variation       1691
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746680189"
     variation       1700
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189371434"
     variation       1714..1718
                     /gene="NANOG"
                     /replace="aa"
                     /replace="aagaa"
                     /db_xref="dbSNP:1478385855"
     variation       1716
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:955183370"
     variation       1720
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1592119011"
     variation       1721
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1193387808"
     variation       1729
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:57319797"
     variation       1732
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458526306"
     variation       1738
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1362400507"
     variation       1739
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1592119019"
     variation       1746..1756
                     /gene="NANOG"
                     /replace="gtatt"
                     /replace="gtattcgtatt"
                     /db_xref="dbSNP:1158771668"
     variation       1750
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1407551228"
     variation       1751
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:57915951"
     variation       1752
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:527625467"
     variation       1754
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1468088184"
     variation       1760
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248768544"
     variation       1765
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1592119028"
     variation       1766..1769
                     /gene="NANOG"
                     /replace="tggg"
                     /replace="tgggtggg"
                     /db_xref="dbSNP:1164888121"
     variation       1771
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:985210049"
     variation       1773
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1422370733"
     variation       1777
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1260397441"
     variation       1781
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1312568107"
     variation       1782..1787
                     /gene="NANOG"
                     /replace="tttttt"
                     /replace="ttttttt"
                     /db_xref="dbSNP:1299594144"
     variation       1792
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1305518895"
     variation       1794..1796
                     /gene="NANOG"
                     /replace="t"
                     /replace="tat"
                     /db_xref="dbSNP:1438702834"
     variation       1795
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:910970703"
     variation       1801..1802
                     /gene="NANOG"
                     /replace="gt"
                     /replace="gtgt"
                     /db_xref="dbSNP:776236707"
     variation       1808
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1592119048"
     variation       1812
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:935862337"
     variation       1816
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1268167776"
     variation       1819
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:989930779"
     variation       1823
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1287939248"
     variation       1827
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1466864835"
     variation       1829
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1381315449"
     variation       1837..1838
                     /gene="NANOG"
                     /replace=""
                     /replace="ggc"
                     /db_xref="dbSNP:201124730"
     variation       1838
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:55702142"
     variation       1839
                     /gene="NANOG"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1204590917"
     variation       1839
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56242982"
     variation       1840..1841
                     /gene="NANOG"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:200881551"
     variation       1841..1842
                     /gene="NANOG"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:753756549"
     variation       1841
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148073342"
     variation       1847
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1445359532"
     variation       1850..1853
                     /gene="NANOG"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1261226343"
     variation       1852
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778799326"
     variation       1853
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1201300984"
     variation       1861
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:913026907"
     variation       1861
                     /gene="NANOG"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1483449764"
     variation       1862
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1358746425"
     variation       1866..1869
                     /gene="NANOG"
                     /replace="c"
                     /replace="cccc"
                     /db_xref="dbSNP:1346998739"
     variation       1866
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866562247"
     variation       1868
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35472045"
     variation       1874
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1228885490"
     variation       1880
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1324234044"
     variation       1889..1891
                     /gene="NANOG"
                     /replace=""
                     /replace="atc"
                     /db_xref="dbSNP:1317193248"
     variation       1895
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1396290040"
     variation       1905
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182372778"
     variation       1909
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34237790"
     variation       1910
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1434526320"
     variation       1921
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1170165890"
     variation       1923
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1046018424"
     variation       1924
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372641023"
     variation       1925
                     /gene="NANOG"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1188464178"
     variation       1941
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:34367740"
     variation       1951
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474074917"
     variation       1961..1963
                     /gene="NANOG"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1208409182"
     variation       1970
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1485223951"
     variation       1971..1976
                     /gene="NANOG"
                     /replace="aac"
                     /replace="aacaac"
                     /db_xref="dbSNP:1182887670"
     variation       1973
                     /gene="NANOG"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1412465215"
     variation       1973
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367992868"
     variation       1976
                     /gene="NANOG"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1442307213"
     variation       1976
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:35212015"
     variation       1986..1988
                     /gene="NANOG"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1380573311"
     variation       1986
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1418695626"
     variation       1991
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1315989157"
     variation       2001
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356936214"
     variation       2002
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:906540223"
     variation       2004
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1592119136"
     variation       2012
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:564304820"
     variation       2015
                     /gene="NANOG"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:939325079"
     variation       2021
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1351547555"
     variation       2022
                     /gene="NANOG"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:34956956"
     variation       2025
                     /gene="NANOG"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1395830645"
     variation       2027
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302251544"
     variation       2030
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:895212855"
     variation       2034
                     /gene="NANOG"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1380482607"
     variation       2048
                     /gene="NANOG"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115123983"
ORIGIN      
ataaatctagagactccaggattttaacgttctgctggactgagctggttgcctcatgttattatgcaggcaactcactttatcccaatttcttgatacttttccttctggaggtcctatttctctaacatcttccagaaaagtcttaaagctgccttaaccttttttccagtccacctcttaaattttttcctcctcttcctctatactaacatgagtgtggatccagcttgtccccaaagcttgccttgctttgaagcatccgactgtaaagaatcttcacctatgcctgtgatttgtgggcctgaagaaaactatccatccttgcaaatgtcttctgctgagatgcctcacacggagactgtctctcctcttccttcctccatggatctgcttattcaggacagccctgattcttccaccagtcccaaaggcaaacaacccacttctgcagagaagagtgtcgcaaaaaaggaagacaaggtcccggtcaagaaacagaagaccagaactgtgttctcttccacccagctgtgtgtactcaatgatagatttcagagacagaaatacctcagcctccagcagatgcaagaactctccaacatcctgaacctcagctacaaacaggtgaagacctggttccagaaccagagaatgaaatctaagaggtggcagaaaaacaactggccgaagaatagcaatggtgtgacgcagggatgcctggtgaacccgactgggaaccttccaatgtggagcaaccagacctggaacaattcaacctggagcaaccagacccagaacatccagtcctggagcaaccactcctggaacactcagacctggtgcacccaatcctggaacaatcaggcctggaacagtcccttctataactgtggagaggaatctctgcagtcctgcatgcagttccagccaaattctcctgccagtgacttggaggctgccttggaagctgctggggaaggccttaatgtaatacagcagaccactaggtattttagtactccacaaaccatggatttattcctaaactactccatgaacatgcaacctgaagacgtgtgaagatgagtgaaactgatattactcaatttcagtctggacactggctgaatccttcctctcccctcctcccatccctcataggatttttcttgtttggaaaccacgtgttctggtttccatgatgcccatccagtcaatctcatggagggtggagtatggttggagcctaatcagcgaggtttctttttttttttttttcctattggatcttcctggagaaaatactttttttttttttttttttgaaacggagtcttgctctgtcgcccaggctggagtgcagtggcgcggtcttggctcactgcaagctccgtctcccgggttcacgccattctcctgcctcagcctcccgagcagctgggactacaggcgcccgccacctcgcccggctaatattttgtatttttagtagagacggggtttcactgtgttagccaggatggtctcgatctcctgaccttgtgatccacccgcctcggcctccctaacagctgggatttacaggcgtgagccaccgcgccctgcctagaaaagacattttaataaccttggctgccgtctctggctatagataagtagatctaatactagtttggatatctttagggtttagaatctaacctcaagaataagaaatacaagtacaaattggtgatgaagatgtattcgtattgtttgggattgggaggctttgcttattttttaaaaactattgaggtaaagggttaagctgtaacatacttaattgatttcttaccgtttttggctctgttttgctatatcccctaatttgttggttgtgctaatctttgtagaaagaggtctcgtatttgctgcatcgtaatgacatgagtactgctttagttggtttaagttcaaatgaatgaaacaactatttttcctttagttgattttaccctgatttcaccgagtgtttcaatgagtaaatatacagcttaaacataa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]