LOCUS       NM_001277769             826 bp    mRNA    linear   VRT 29-JUN-2020
DEFINITION  Gallus gallus claudin 10 (CLDN10), transcript variant 3, mRNA.
ACCESSION   NM_001277769
VERSION     NM_001277769.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 826)
  AUTHORS   Collins MM, Baumholtz AI, Simard A, Gregory M, Cyr DG and Ryan AK.
  TITLE     Claudin-10 is required for relay of left-right patterning cues from
            Hensen's node to the lateral plate mesoderm
  JOURNAL   Dev. Biol. 401 (2), 236-248 (2015)
   PUBMED   25744724
  REMARK    GeneRIF: The data demonstrate a novel role for Claudin-10 during
            the transmission of laterality information from Hensen's node to
            both the left and right sides of the embryo. [claudin-10]
REFERENCE   2  (bases 1 to 826)
  AUTHORS   Seo HW, Rengaraj D, Choi JW, Ahn SE, Song YS, Song G and Han JY.
  TITLE     Claudin 10 is a glandular epithelial marker in the chicken model as
            human epithelial ovarian cancer
  JOURNAL   Int. J. Gynecol. Cancer 20 (9), 1465-1473 (2010)
   PUBMED   21370593
  REMARK    GeneRIF: New insight into using the chicken as a suitable animal
            model for investigating the effect and function of CLDN in human
            ovarian cancer.
REFERENCE   3  (bases 1 to 826)
  AUTHORS   Carre W, Wang X, Porter TE, Nys Y, Tang J, Bernberg E, Morgan R,
            Burnside J, Aggrey SE, Simon J and Cogburn LA.
  TITLE     Chicken genomics resource: sequencing and annotation of 35,407 ESTs
            from single and multiple tissue cDNA libraries and CAP3 assembly of
            a chicken gene index
  JOURNAL   Physiol. Genomics 25 (3), 514-524 (2006)
   PUBMED   16554550
REFERENCE   4  (bases 1 to 826)
  AUTHORS   Boardman PE, Sanz-Ezquerro J, Overton IM, Burt DW, Bosch E, Fong
            WT, Tickle C, Brown WR, Wilson SA and Hubbard SJ.
  TITLE     A comprehensive collection of chicken cDNAs
  JOURNAL   Curr. Biol. 12 (22), 1965-1969 (2002)
   PUBMED   12445392
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CV038199.1, CD216622.1, BX930125.1 and AADN05000384.1.
            
            Transcript Variant: This variant (3) has an alternate first exon in
            place of the first exon of variant 1. The resulting isoform (3) has
            a shorter and distinct N-terminus compared to isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BU287383.1, ERR2365562.148579.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2201360, SAMEA2201361
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-108               CV038199.1         100-207
            109-322             CD216622.1         208-421
            323-818             BX930125.1         454-949
            819-826             AADN05000384.1     6787911-6787918
FEATURES             Location/Qualifiers
     source          1..826
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="1"
                     /map="1"
                     /breed="Leghorn"
     gene            1..826
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /note="claudin 10"
                     /db_xref="CGNC:13756"
                     /db_xref="GeneID:418790"
     exon            1..93
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="alignment:Splign:2.1.0"
     CDS             24..560
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /note="isoform 3 is encoded by transcript variant 3"
                     /codon_start=1
                     /product="claudin-10 isoform 3"
                     /protein_id="NP_001264698.1"
                     /db_xref="CGNC:13756"
                     /db_xref="GeneID:418790"
                     /translation="

MNCAGNALGAFHCRPHLTIFKVEGYIQACRGLMISAVCLGFFGSVFGLVGMKCTKIGGSDQNKARIACLAGLIFILCGLCSMTGCSLYAHRITSEFFDPSFVAQKYELGAALFIGWAGASLCIIGGSIFCFSIAENSKSPRRAYAYNGAASVMSSRTKIHNSVPDKTSPKHFDKNAYV"

     misc_feature    <81..410
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
     exon            94..255
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="alignment:Splign:2.1.0"
     exon            256..337
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="alignment:Splign:2.1.0"
     exon            338..445
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="alignment:Splign:2.1.0"
     exon            446..826
                     /gene="CLDN10"
                     /gene_synonym="claudin-10"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

cctgggttttccagggtctgtggatgaactgtgcgggcaacgcgctgggtgcttttcactgcagacctcaccttactatcttcaaagtggaaggttacatccaagcctgcagaggactgatgatctccgctgtctgtctgggtttctttggctccgtttttggactggttgggatgaagtgcacaaaaatcggcggctctgatcaaaataaagcaagaatagcttgtttagctggactgattttcatactgtgtgggctgtgctccatgactggttgttccctgtatgcacacaggattacgtctgagttctttgatccttcttttgttgcacaaaagtatgaattaggagcagctttattcattggatgggctggagcttcactctgcatcattggtggcagtatattctgcttctcaatagctgagaacagtaaatctccaaggagagcgtatgcatataatggagccgcatctgtgatgtcgtctcgtacaaagattcacaacagtgtcccagacaaaacctcaccaaagcactttgacaagaacgcttacgtttaagtgtacttttctaagatctgaagccagttttaaaaatgagtttgtatgtttcattcagggtgatttccccccccacctccccacaacacaatggaattaccactaagaatgaatttgtaaggtgttatcttgcagctttttccacgttgatgtaaattttattatattttaagattgatgtttgtattataaagtttatacctgcaaatcatgcattgatgctgctttctaaaaaagaaaaataaagagggtatttacagatgcag

//