LOCUS       NM_001270791             950 bp    mRNA    linear   ROD 29-JUN-2025
DEFINITION  Mus musculus IBA57 homolog, iron-sulfur cluster assembly (Iba57),
            transcript variant 2, mRNA; nuclear gene for mitochondrial product.
ACCESSION   NM_001270791 XM_003688885
VERSION     NM_001270791.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 950)
  AUTHORS   Waller,J.C., Alvarez,S., Naponelli,V., Lara-Nunez,A., Blaby,I.K.,
            Da Silva,V., Ziemak,M.J., Vickers,T.J., Beverley,S.M., Edison,A.S.,
            Rocca,J.R., Gregory,J.F. 3rd, de Crecy-Lagard,V. and Hanson,A.D.
  TITLE     A role for tetrahydrofolates in the metabolism of iron-sulfur
            clusters in all domains of life
  JOURNAL   Proc Natl Acad Sci U S A 107 (23), 10412-10417 (2010)
   PUBMED   20489182
  REMARK    GeneRIF: Mouse COG0354 represents an ancient, folate-dependent
            protein family involved in the metabolism of Fe/S cluster
            containing enzymes
REFERENCE   2  (bases 1 to 950)
  AUTHORS   Nilsson,R., Schultz,I.J., Pierce,E.L., Soltis,K.A.,
            Naranuntarat,A., Ward,D.M., Baughman,J.M., Paradkar,P.N.,
            Kingsley,P.D., Culotta,V.C., Kaplan,J., Palis,J., Paw,B.H. and
            Mootha,V.K.
  TITLE     Discovery of genes essential for heme biosynthesis through
            large-scale gene expression analysis
  JOURNAL   Cell Metab 10 (2), 119-130 (2009)
   PUBMED   19656490
  REMARK    GeneRIF: Required for functional heme biosynthesis in erythroid
            cells.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL645854.10, BM935743.1 and AW488265.1.
            
            On Aug 2, 2012 this sequence version replaced XM_003688885.1.
            
            Transcript Variant: This variant (2) contains alternate 3' exon
            structure and it thus differs in the 3' coding region and 3' UTR,
            compared to variant 1. The encoded isoform (2) has a distinct
            C-terminus and is shorter than isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BM935743.1, SRR7345562.1698026.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164131, SAMN01164132
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: reported by MitoCarta
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-98                AL645854.10        146991-147088       c
            99-673              BM935743.1         54-628
            674-950             AW488265.1         1-277               c
FEATURES             Location/Qualifiers
     source          1..950
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="11"
                     /map="11 36.97 cM"
     gene            1..950
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /note="IBA57 homolog, iron-sulfur cluster assembly"
                     /db_xref="GeneID:216792"
                     /db_xref="MGI:MGI:3041174"
     exon            1..395
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /inference="alignment:Splign:2.1.0"
     CDS             55..759
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /note="isoform 2 precursor is encoded by transcript
                     variant 2; putative transferase C1orf69 homolog,
                     mitochondrial; putative transferase CAF17 homolog,
                     mitochondrial; iron-sulfur cluster assembly factor
                     homolog; IBA57, iron-sulfur cluster assembly homolog;
                     iron-sulfur cluster assembly factor IBA57, mitochondrial"
                     /codon_start=1
                     /product="iron-sulfur cluster assembly factor IBA57,
                     mitochondrial isoform 2 precursor"
                     /protein_id="NP_001257720.1"
                     /db_xref="GeneID:216792"
                     /db_xref="MGI:MGI:3041174"
                     /translation="

MAAVALLRGAAVGRRSPAWHWRLSGTASHCLARGFGLLGSNPADGVAWTCFRLDGRALVRVRGPDAAPFLLGLSTNELPLSGPPTGAAQPSARAAYAHFLNVQGRTLYDVILYGLLLNCSAVASAVRQLAGLPSLQLWLVNCSAAAATTAVPPPLLTSAVSAASFCYQPSPHYRKQEKKMERSLFSGLLLPHWGKAQESLPTTSLSEPSQPVCIAPERMFGPITDLPIGNLRND"

     misc_feature    229..>393
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /note="Glycine cleavage system protein T
                     (aminomethyltransferase) [Amino acid transport and
                     metabolism]; Region: GcvT; COG0404"
                     /db_xref="CDD:440173"
     exon            396..935
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /inference="alignment:Splign:2.1.0"
     regulatory      915..920
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /note="hexamer: GATAAA"
     polyA_site      935
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /note="major polyA site"
ORIGIN      

gccgccgccgccgcccggggccgctgtggtgcccgccttcacttagcgcccaagatggcagcggtggcgctgcttcggggcgcggctgtggggcgcagaagcccagcttggcactggcggctgagcgggaccgcgagtcactgcctagcccgtggctttggccttcttggcagcaaccccgcggacggtgtggcctggacttgcttccggctggacgggcgcgccttagtgcgcgtgcgcggcccggacgctgcacccttcctgttgggactatcgaccaatgagctgccgctttcggggcctccgaccggcgcggctcagccctctgcgcgtgcggcgtatgcccatttcctgaatgtgcagggacgcacgctctatgacgtcattctgtatgggctgttgttgaactgctcagctgtcgcttcagctgtcagacagctggcaggcttgccttccctgcagctttggcttgtcaactgctcagctgctgccgccaccactgcagttccaccgcctctgctgacctctgctgtctctgctgcttctttctgttaccagcccagcccacactacagaaagcaagaaaagaaaatggagagaagccttttctcgggcctgctgctcccacactggggcaaagctcaggaaagtcttcccacaacctcactaagtgagccttcacagcctgtttgtatcgccccagaaaggatgtttggaccaatcacagacttgcctatcggcaaccttcgtaatgactgaggattgtgttttggacagccataacgctgcatctttagcaatagttacagcagatcctcttctaggctaccagggagctgctgtccatttggccaaattgaaagtggttgcaagatcatctagaattcagtgagacctgtaatggcaaaatgtctgataaaaaccattttaaacaaaaaaaaaaaaaaaaa

//