GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:26:49, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001270525            2935 bp    mRNA    linear   PRI 21-JAN-2020
DEFINITION  Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 5,
            mRNA.
ACCESSION   NM_001270525
VERSION     NM_001270525.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2935)
  AUTHORS   Figueira Muoio VM, Uno M, Oba-Shinjo S, da Silva R, Araujo Pereira
            BJ, Clara C, Matushita H and Marie SNK.
  TITLE     OTX1 and OTX2 Genes in Medulloblastoma
  JOURNAL   World Neurosurg 127, e58-e64 (2019)
   PUBMED   30797919
  REMARK    GeneRIF: The OTX2 gene was expressed in 62% of 60 Brazilian
            medulloblastoma patients. Expression varied with age (higher in
            younger age groups), location (predominantly vermis), and
            histological type (classic and anaplastic). A statistical
            correlation between OTX2 gene expression and the development of
            leptomeningeal metastases was observed.
            Erratum:[World Neurosurg. 2019 Oct;130:377. PMID: 31421436]
REFERENCE   2  (bases 1 to 2935)
  AUTHORS   Sakai A and Sugiyama S.
  TITLE     Experience-dependent transcriptional regulation in juvenile brain
            development
  JOURNAL   Dev. Growth Differ. 60 (8), 473-482 (2018)
   PUBMED   30368782
  REMARK    GeneRIF: It identified downstream targets of Otx2 suggest novel
            roles of Otx2 in homeostasis of PV cells, and, moreover, in
            regulation of chromatin state, which is important for neuronal
            plasticity.
            Review article
REFERENCE   3  (bases 1 to 2935)
  AUTHORS   Kaufman J, Wymbs NF, Montalvo-Ortiz JL, Orr C, Albaugh MD, Althoff
            R, O'Loughlin K, Holbrook H, Garavan H, Kearney C, Yang BZ, Zhao H,
            Pena C, Nestler EJ, Lee RS, Mostofsky S, Gelernter J and Hudziak J.
  TITLE     Methylation in OTX2 and related genes, maltreatment, and depression
            in children
  JOURNAL   Neuropsychopharmacology 43 (11), 2204-2211 (2018)
   PUBMED   30089883
  REMARK    GeneRIF: Maltreatment history and DNA methylation in OTX2
            significantly predicted depression in children.
REFERENCE   4  (bases 1 to 2935)
  AUTHORS   Su Z, Zhang Y, Liao B, Zhong X, Chen X, Wang H, Guo Y, Shan Y, Wang
            L and Pan G.
  TITLE     Antagonism between the transcription factors NANOG and OTX2
            specifies rostral or caudal cell fate during neural patterning
            transition
  JOURNAL   J. Biol. Chem. 293 (12), 4445-4455 (2018)
   PUBMED   29386354
  REMARK    GeneRIF: have uncovered a mutual antagonism between NANOG and OTX2
            underlying cell fate decisions during neural patterning, critical
            for the regulation of early neural development in humans
REFERENCE   5  (bases 1 to 2935)
  AUTHORS   Fong SL and Fong WB.
  TITLE     Elements regulating the transcription of human interstitial
            retinoid-binding protein (IRBP) gene in cultured retinoblastoma
            cells
  JOURNAL   Curr. Eye Res. 18 (4), 283-291 (1999)
   PUBMED   10372988
REFERENCE   6  (bases 1 to 2935)
  AUTHORS   Bobola N, Briata P, Ilengo C, Rosatto N, Craft C, Corte G and
            Ravazzolo R.
  TITLE     OTX2 homeodomain protein binds a DNA element necessary for
            interphotoreceptor retinoid binding protein gene expression
  JOURNAL   Mech. Dev. 82 (1-2), 165-169 (1999)
   PUBMED   10354480
REFERENCE   7  (bases 1 to 2935)
  AUTHORS   Nagao T, Leuzinger S, Acampora D, Simeone A, Finkelstein R,
            Reichert H and Furukubo-Tokunaga K.
  TITLE     Developmental rescue of Drosophila cephalic defects by the human
            Otx genes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 95 (7), 3737-3742 (1998)
   PUBMED   9520436
REFERENCE   8  (bases 1 to 2935)
  AUTHORS   Kastury K, Druck T, Huebner K, Barletta C, Acampora D, Simeone A,
            Faiella A and Boncinelli E.
  TITLE     Chromosome locations of human EMX and OTX genes
  JOURNAL   Genomics 22 (1), 41-45 (1994)
   PUBMED   7959790
REFERENCE   9  (bases 1 to 2935)
  AUTHORS   Kumaran,N., Pennesi,M.E., Yang,P., Trzupek,K.M., Schlechter,C.,
            Moore,A.T., Weleber,R.G. and Michaelides,M.
  TITLE     Leber Congenital Amaurosis / Early-Onset Severe Retinal Dystrophy
            Overview
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   30285347
REFERENCE   10 (bases 1 to 2935)
  AUTHORS   Bardakjian,T., Weiss,A. and Schneider,A.
  TITLE     Microphthalmia/Anophthalmia/Coloboma Spectrum
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   20301552
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL161757.4, AB593056.1,
            BU176852.1 and BC032579.1.
            On Jun 2, 2019 this sequence version replaced NM_001270525.1.
            
            Summary: This gene encodes a member of the bicoid subfamily of
            homeodomain-containing transcription factors. The encoded protein
            acts as a transcription factor and plays a role in brain,
            craniofacial, and sensory organ development. The encoded protein
            also influences the proliferation and differentiation of
            dopaminergic neuronal progenitor cells during mitosis. Mutations in
            this gene cause syndromic microphthalmia 5 (MCOPS5) and combined
            pituitary hormone deficiency 6 (CPHD6). This gene is also suspected
            of having an oncogenic role in medulloblastoma. Alternative
            splicing results in multiple transcript variants encoding distinct
            isoforms. Pseudogenes of this gene are known to exist on
            chromosomes two and nine. [provided by RefSeq, Jul 2012].
            
            Transcript Variant: This variant (5) differs in the 5' UTR,
            compared to variant 1, and encodes the longer isoform (a). Variants
            1 and 5 encode the same protein (isoform a).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1803615.107525.1, BU176852.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03465402, SAMN03465404
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-4                 AL161757.4         59910-59913
            5-21                AB593056.1         4-20
            22-833              BU176852.1         1-812
            834-2133            BC032579.1         908-2207
            2134-2935           AL161757.4         64871-65672
FEATURES             Location/Qualifiers
     source          1..2935
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q22.3"
     gene            1..2935
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="orthodenticle homeobox 2"
                     /db_xref="GeneID:5015"
                     /db_xref="HGNC:HGNC:8522"
                     /db_xref="MIM:600037"
     exon            1..308
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       15
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1028025946"
     variation       19
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:995663284"
     variation       21
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1187828004"
     variation       25
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:966424967"
     variation       26
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566625629"
     variation       28
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886050561"
     variation       32
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1170533264"
     variation       34
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1401837548"
     variation       42
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1016145843"
     variation       44
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:992379797"
     variation       50
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:959615923"
     variation       51
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1386513381"
     misc_feature    53..55
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="upstream in-frame stop codon"
     variation       57
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1266672856"
     variation       61
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1441681039"
     variation       63
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1241496038"
     variation       67..80
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tgtttgtttg"
                     /replace="tgtttgtttgtttg"
                     /db_xref="dbSNP:886050560"
     variation       74
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1033848381"
     variation       81
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:995710328"
     variation       86
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1208936281"
     variation       111
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:867047559"
     variation       115
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463179835"
     variation       116
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1267978893"
     variation       120
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:566671671"
     variation       130
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:540831263"
     variation       146
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196562062"
     variation       147
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056716757"
     variation       148
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1015703211"
     variation       153
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1473067950"
     variation       154
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161674671"
     variation       161
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:546858272"
     variation       162
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747816534"
     variation       165
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776104541"
     variation       166
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200002729"
     variation       167
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326480147"
     variation       168
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373972732"
     variation       169
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564618315"
     variation       170..174
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1566625502"
     variation       170
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1312165040"
     variation       171
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779606022"
     variation       174
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758339288"
     variation       175
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1173169407"
     variation       177
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:905188703"
     variation       179
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:546311189"
     variation       183
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370535121"
     variation       185
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757069643"
     variation       191
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754146678"
     variation       192
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209340201"
     variation       194
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1486905888"
     variation       195
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764157150"
     variation       202
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1230570861"
     variation       203
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756345000"
     variation       204
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1349359874"
     variation       205
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752785578"
     variation       206
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1051054473"
     CDS             212..1105
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="isoform a is encoded by transcript variant 5;
                     homeobox protein OTX2; orthodenticle homolog 2"
                     /codon_start=1
                     /product="homeobox protein OTX2 isoform a"
                     /protein_id="NP_001257454.1"
                     /db_xref="CCDS:CCDS9728.1"
                     /db_xref="GeneID:5015"
                     /db_xref="HGNC:HGNC:8522"
                     /db_xref="MIM:600037"
                     /translation="
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL"
     misc_feature    order(350..364,368..370,419..421,437..439,476..478,
                     482..487,494..499,503..511,515..517)
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(356..358,365..367,485..487,494..499,506..508)
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    359..517
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:333795"
     misc_feature    692..937
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="Otx1 transcription factor; Region: TF_Otx;
                     pfam03529"
                     /db_xref="CDD:308893"
     variation       213
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350877109"
     variation       215
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767603643"
     variation       216
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412709573"
     variation       220
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:575736431"
     variation       226
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752010967"
     variation       234
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1400172157"
     variation       235
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382934738"
     variation       236
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766756721"
     variation       241
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997349229"
     variation       242
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763234678"
     variation       244
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1186172721"
     variation       249
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776356711"
     variation       250
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768254721"
     variation       253
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760374061"
     variation       256
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946757953"
     variation       265
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1445883508"
     variation       268
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774907916"
     variation       269
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771687556"
     variation       272
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1207963480"
     variation       273
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745822138"
     variation       274
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:779418668"
     variation       275
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200680654"
     variation       277
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778956556"
     variation       280
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770855748"
     variation       287
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749151724"
     variation       289..292
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:786205874"
     variation       290
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259224286"
     variation       295
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1284677631"
     variation       296
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777618282"
     variation       300
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756331034"
     variation       306
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752941534"
     exon            309..484
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       310
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1248637885"
     variation       311
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371205339"
     variation       312
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1232831265"
     variation       317
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761773984"
     variation       326
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751692939"
     variation       329
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780106127"
     variation       333
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1449513107"
     variation       336..341
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:758119168"
     variation       336
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:758946986"
     variation       337
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750923926"
     variation       338
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374042850"
     variation       341
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1440715201"
     variation       352
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566624596"
     variation       354
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1555350405"
     variation       361
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246931412"
     variation       366
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203506236"
     variation       367
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1435887362"
     variation       373
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757602259"
     variation       378
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1229104622"
     variation       379
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354433789"
     variation       382
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347231732"
     variation       384..410
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="tagatgtgctggaagcactgtttgcca"
                     /db_xref="dbSNP:886044145"
     variation       387
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:567955379"
     variation       398
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368759331"
     variation       402..404
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gg"
                     /replace="tgt"
                     /db_xref="dbSNP:1555350397"
     variation       402
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1368488675"
     variation       403
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141664597"
     variation       414
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759256101"
     variation       415
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774043425"
     variation       418
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765964221"
     variation       422
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1064795810"
     variation       424
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762821214"
     variation       427
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867835552"
     variation       429
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1374187856"
     variation       437
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773157352"
     variation       446
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1434432414"
     variation       454..471
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ga"
                     /replace="gaaaatcaacttgcccga"
                     /db_xref="dbSNP:1566624472"
     variation       457
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1390373654"
     variation       469
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769477143"
     variation       470
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:786205224"
     variation       475
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376651816"
     variation       481
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747916036"
     exon            485..2935
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       485
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397190102"
     variation       500
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:104894464"
     variation       501
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200990681"
     variation       505
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1566623392"
     variation       507
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1555350254"
     variation       516
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:990697953"
     variation       518..537
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="caacaacagca"
                     /replace="caacaacagcaacaacagca"
                     /db_xref="dbSNP:1432265442"
     variation       518
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78953717"
     variation       520
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749788509"
     variation       527
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:786205884"
     variation       538
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867373003"
     variation       539
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566623353"
     variation       541
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778304481"
     variation       547
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536495343"
     variation       552
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751258203"
     variation       561
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779696471"
     variation       562
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757971368"
     variation       563
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750013761"
     variation       564
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1421844456"
     variation       568
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958176763"
     variation       573
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764625033"
     variation       577
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761862286"
     variation       582
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753729345"
     variation       583
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763911822"
     variation       584
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760396081"
     variation       587
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:925178840"
     variation       588
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1267666192"
     variation       590
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775702810"
     variation       591
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199799627"
     variation       593
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867148217"
     variation       596
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1294096975"
     variation       597
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774537529"
     variation       599
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748205899"
     variation       603
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:970116042"
     variation       607
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749843466"
     variation       612
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778357805"
     variation       617
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770291855"
     variation       622
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772021946"
     variation       623
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74658806"
     variation       624
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:867304376"
     variation       629
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758106958"
     variation       632..637
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:1555350223"
     variation       632
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376333965"
     variation       634
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372008404"
     variation       635
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753783256"
     variation       636
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199761861"
     variation       637..640
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ctct"
                     /replace="ctctct"
                     /db_xref="dbSNP:1566623121"
     variation       637
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:553884027"
     variation       648
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:786205879"
     variation       652
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1018175216"
     variation       654
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201721391"
     variation       655
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147896150"
     variation       657
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771047348"
     variation       658
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763064579"
     variation       662
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770486100"
     variation       663
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748631596"
     variation       664
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777104497"
     variation       666
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768857621"
     variation       667
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325619239"
     variation       669
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040844433"
     variation       670
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34537598"
     variation       675
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200171280"
     variation       677
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1306099663"
     variation       688
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373798705"
     variation       693
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345597863"
     variation       694
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538192166"
     variation       698..699
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gc"
                     /replace="gcgc"
                     /db_xref="dbSNP:786205873"
     variation       698
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173013598"
     variation       705
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:756087368"
     variation       715
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752526255"
     variation       725
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370354056"
     variation       730
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868464317"
     variation       732
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1224751397"
     variation       736
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767374937"
     variation       745
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:886043793"
     variation       751
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368033398"
     variation       754
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1184804231"
     variation       756
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566622915"
     variation       761
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751820068"
     variation       763
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:766762080"
     variation       764
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1209472542"
     variation       767
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344213875"
     variation       772
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:104894465"
     variation       778
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1257366193"
     variation       785
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773463323"
     variation       787
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1334931058"
     variation       789
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286159089"
     variation       791
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765382721"
     variation       792
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762435469"
     variation       795
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776964451"
     variation       797
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:397514463"
     variation       798
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142205965"
     variation       802
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747279627"
     variation       803
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1173365017"
     variation       808
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775913832"
     variation       812
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748910557"
     variation       813
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755578825"
     variation       825
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473138354"
     variation       826
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1216205714"
     variation       827
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:907201088"
     variation       835
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1196833377"
     variation       844
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1257411968"
     variation       852
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150982073"
     variation       854
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780929725"
     variation       857
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1470784217"
     variation       866
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754929157"
     variation       867
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751376563"
     variation       869..870
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ct"
                     /replace="g"
                     /db_xref="dbSNP:1566622642"
     variation       872
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548455339"
     variation       874
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142743327"
     variation       875
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374968145"
     variation       876
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1213822105"
     variation       878
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419408753"
     variation       879
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916022550"
     variation       881..884
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1566622571"
     variation       884
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750626422"
     variation       885
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:928898444"
     variation       888
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765441049"
     variation       890
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868121860"
     variation       891
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761733794"
     variation       893
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:529946021"
     variation       894..904
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gt"
                     /replace="gtcccatgggt"
                     /db_xref="dbSNP:745480462"
     variation       895
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1281107964"
     variation       902
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209058851"
     variation       904
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764571884"
     variation       909
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370761964"
     variation       916
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775876318"
     variation       924
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144449264"
     variation       926
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772782540"
     variation       931
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1330502209"
     variation       935
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769304167"
     variation       939
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1006268708"
     variation       942
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747665958"
     variation       945
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868295626"
     variation       950
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143131956"
     variation       954
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199650198"
     variation       955
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1026307269"
     variation       959
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768514532"
     variation       960
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746941491"
     variation       961
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1292858286"
     variation       964
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210252921"
     variation       965
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1555350163"
     variation       968
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139800030"
     variation       969
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758228717"
     variation       975
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781096873"
     variation       976
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:977939396"
     variation       977
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1358330775"
     variation       979
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1284735568"
     variation       980
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993488539"
     variation       981
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363170287"
     variation       990..995
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caacca"
                     /db_xref="dbSNP:1555350156"
     variation       990
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322804815"
     variation       993
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750679604"
     variation       994
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1364445625"
     variation       998
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867979918"
     variation       1003
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290281755"
     variation       1008
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:779220317"
     variation       1018
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1321908772"
     variation       1035
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1407465215"
     variation       1037
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1164601677"
     variation       1042
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78559885"
     variation       1051
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201396096"
     variation       1055
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:764205900"
     variation       1056
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:964796364"
     variation       1058
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1566622143"
     variation       1073
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017328977"
     variation       1077
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761138937"
     variation       1083
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753156713"
     variation       1084
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759833842"
     variation       1092
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774680300"
     variation       1096
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1219049095"
     variation       1107
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370275924"
     variation       1110
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776053080"
     variation       1111
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204435968"
     variation       1115
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:171978"
     variation       1116
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340168757"
     variation       1122..1126
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tttt"
                     /replace="ttttt"
                     /replace="tttttt"
                     /db_xref="dbSNP:1197615289"
     variation       1124
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1299838408"
     variation       1125
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192883185"
     variation       1127
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:889592710"
     variation       1130
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229234977"
     variation       1131
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780072062"
     variation       1132
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273316573"
     variation       1133
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457686689"
     variation       1135
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772006682"
     variation       1139
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182392988"
     variation       1145
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1245381513"
     variation       1146
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3742576"
     variation       1147
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866064360"
     variation       1148
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:558072316"
     variation       1149..1151
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1566622028"
     variation       1149
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485650070"
     variation       1151
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757464106"
     variation       1156
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428446118"
     variation       1161
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993744729"
     variation       1163
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:907483952"
     variation       1180
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1329597774"
     variation       1184..1187
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1398080713"
     variation       1193
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1463821799"
     variation       1194
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465056084"
     variation       1207
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337262345"
     variation       1216
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1399289149"
     variation       1226
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:575988911"
     variation       1229
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:555242082"
     variation       1230
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:561466216"
     variation       1231
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750146313"
     variation       1237
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1190100508"
     variation       1240
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229755388"
     variation       1245
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:894481205"
     variation       1251
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543291377"
     variation       1252
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1478094910"
     variation       1257
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482490326"
     variation       1258
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:928301679"
     variation       1261
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:981657803"
     variation       1263
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1255131942"
     variation       1265
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75947588"
     variation       1268
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764880954"
     variation       1270
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195329294"
     variation       1278
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420874693"
     variation       1280
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477169612"
     variation       1283
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:916081360"
     variation       1284
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1360812788"
     variation       1302
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464414724"
     variation       1308
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:985397680"
     variation       1312
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:952150059"
     variation       1324
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050559"
     variation       1328
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1402106303"
     variation       1332
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026840321"
     variation       1333
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903692952"
     variation       1335
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224139958"
     variation       1353
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042235855"
     variation       1356
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:945281239"
     variation       1359
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:923213099"
     variation       1361..1368
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caaaagca"
                     /db_xref="dbSNP:976420913"
     variation       1366
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:553969803"
     variation       1367
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972142607"
     variation       1373
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:943019365"
     variation       1378
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538805998"
     variation       1379
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1487017770"
     variation       1382
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1218381719"
     variation       1386
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1260532137"
     variation       1395
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1487705519"
     variation       1397
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199472030"
     variation       1413
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1427268662"
     variation       1421
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142727455"
     variation       1426
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1219845536"
     variation       1442
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984556416"
     variation       1443
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951811707"
     variation       1444
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556614831"
     variation       1445
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:3215889"
     variation       1446
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:869122184"
     variation       1446
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1555350067"
     variation       1447
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889740596"
     variation       1450
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:537889967"
     variation       1455
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1281712076"
     variation       1458
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1028147110"
     variation       1461
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295354677"
     variation       1464
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567634820"
     variation       1471
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219167817"
     variation       1476
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1331775492"
     variation       1482
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:971574768"
     variation       1488
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1024531987"
     variation       1492
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372333803"
     variation       1493
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1013593016"
     variation       1502
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1011851024"
     variation       1509
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621702"
     variation       1513
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357328033"
     variation       1519
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175318513"
     variation       1522
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164324256"
     variation       1527
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566621689"
     variation       1529
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:778705827"
     variation       1531
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414498885"
     variation       1532
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761387465"
     variation       1539
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1052830345"
     variation       1541
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190556214"
     variation       1557
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:894436849"
     variation       1565
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1033466446"
     variation       1567
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1251091564"
     variation       1568
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934406906"
     variation       1576
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621652"
     variation       1585
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1441364759"
     variation       1595..1600
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgattg"
                     /db_xref="dbSNP:149455658"
     variation       1596
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369779296"
     variation       1605
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438677729"
     variation       1608
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903304073"
     variation       1614
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754230866"
     variation       1626
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1042182924"
     variation       1631
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1045463851"
     variation       1636
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435793143"
     variation       1642
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868860898"
     variation       1648
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948990605"
     variation       1649
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945186505"
     variation       1651
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379724611"
     variation       1661
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:916180198"
     variation       1665..1670
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caatca"
                     /db_xref="dbSNP:1179283220"
     variation       1670..1671
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:1482497443"
     variation       1671..1678
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gtgtgt"
                     /replace="gtgtgtgt"
                     /db_xref="dbSNP:886050558"
     variation       1671
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:901684336"
     variation       1678
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228539728"
     variation       1683
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291528909"
     variation       1686
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1319424226"
     variation       1687
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237362268"
     variation       1690
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251855513"
     variation       1700
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764392879"
     variation       1710..1713
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1176602266"
     variation       1720
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1211453769"
     variation       1722
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040254525"
     variation       1728..1731
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1486654604"
     variation       1728
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:984960530"
     variation       1734
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1283965626"
     variation       1735
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1411874833"
     variation       1738
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536571793"
     variation       1743
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1239590153"
     variation       1748
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:930784453"
     variation       1752
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050557"
     variation       1753
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:886050556"
     variation       1754
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972087134"
     variation       1755
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:966101197"
     variation       1758..1759
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1331182993"
     variation       1759
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984894491"
     variation       1772
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184421963"
     variation       1781
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1376736111"
     variation       1782
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56245644"
     variation       1785
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1376475442"
     variation       1786
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1227306464"
     variation       1795
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:986127085"
     variation       1796
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621429"
     variation       1797..1808
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ttataa"
                     /replace="ttataattataa"
                     /db_xref="dbSNP:971821568"
     variation       1799
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1319311232"
     variation       1802
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196710335"
     variation       1803
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:58246365"
     variation       1804
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1257294974"
     variation       1811
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448679301"
     variation       1819
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211938034"
     variation       1827
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192422162"
     variation       1834
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1472585406"
     variation       1847
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1028682339"
     variation       1869
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775857186"
     variation       1871
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295783908"
     variation       1872
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1024896852"
     variation       1883
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:957402368"
     variation       1884
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138197536"
     variation       1886
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:998603699"
     variation       1893
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332601359"
     variation       1907
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:906986413"
     variation       1909
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045412281"
     variation       1917
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1013022875"
     variation       1925..1928
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1298354320"
     variation       1927
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:187055500"
     variation       1933
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772253161"
     variation       1935
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1341863555"
     variation       1938
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216233957"
     variation       1948
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1422373370"
     variation       1963
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:549838567"
     variation       2003
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1345627274"
     variation       2015
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220796650"
     variation       2024
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:74517617"
     variation       2025
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:80140046"
     variation       2026
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78935901"
     variation       2027
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759551235"
     variation       2028..2032
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gt"
                     /replace="gtcgt"
                     /db_xref="dbSNP:1000175646"
     variation       2028
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1441567214"
     variation       2030
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781146554"
     variation       2031
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036526594"
     variation       2038
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886050555"
     variation       2039
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192998502"
     variation       2045
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430693238"
     variation       2063
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767628237"
     variation       2068
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1215947126"
     variation       2069
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944782027"
     variation       2070
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488676963"
     variation       2071
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:57390094"
     variation       2072
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967368837"
     variation       2076..2077
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1298489300"
     variation       2077
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:912005555"
     variation       2112
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:986130839"
     variation       2113
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184224534"
     variation       2121
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228720148"
     variation       2131
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020294698"
     variation       2133
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:998230048"
ORIGIN      
gctctttttaagttagtgctggaacgtggaagagctgctgcctccgaagcagtaaaccagcccctctgtttgtttgtttgctttgcccttagttccactgctccaaacccacccaccaaggactctgaacctgtccaccccgggcgcatcaagatcttccagctgggtacccccgatttgggccgactttgcacctccaaacaaccttagcatgatgtcttatcttaagcaaccgccttacgcagtcaatgggctgagtctgaccacttcgggtatggacttgctgcacccctccgtgggctacccggggccctgggcttcttgtcccgcagccaccccccggaaacagcgccgggagaggacgacgttcactcgggcgcagctagatgtgctggaagcactgtttgccaagacccggtacccagacatcttcatgcgagaggaggtggcactgaaaatcaacttgcccgagtcgagggtgcaggtatggtttaagaatcgaagagctaagtgccgccaacaacagcaacaacagcagaatggaggtcaaaacaaagtgagacctgccaaaaagaagacatctccagctcgggaagtgagttcagagagtggaacaagtggccaattcactcccccctctagcacctcagtcccgaccattgccagcagcagtgctcctgtgtctatctggagcccagcttccatctccccactgtcagatcccttgtccacctcctcttcctgcatgcagaggtcctatcccatgacctatactcaggcttcaggttatagtcaaggatatgctggctcaacttcctactttgggggcatggactgtggatcatatttgacccctatgcatcaccagcttcccggaccaggggccacactcagtcccatgggtaccaatgcagtcaccagccatctcaatcagtccccagcttctctttccacccagggatatggagcttcaagcttgggttttaactcaaccactgattgcttggattataaggaccaaactgcctcctggaagcttaacttcaatgctgactgcttggattataaagatcagacatcctcgtggaaattccaggttttgtgaagacctgtagaacctctttttgtgggtgatttttaaatatactgggctggacattccagttttagccaggcattggttaaaagagttagatgggatgatgctcagactcatctgatcaaagttccgagaggcatagaaggaaaaacgaagggccttagaggggcctacaaaccagcaacatgaaatggacaaaccaatctgcttaagatcctgtcatagttttagatcattggttatcctgatttgcaaagtgatcaaaagcattctagccatgtgcaaccaaacaccaccaaaaataaaatcaaacaaaactaagttgtgaaggaagggagggaaggtcatagccttcttaagcagaggtgttccattgttttagccaatccttggttgaatcttaggaatgaacagtgtctcaagctcattcacgtttcatgaccaactggtagttggcactgaaaaaacttttcagggctgtgtgaattgtgtgactgattgtcctagatgcactactttatttaaaaaataatgttcataaggagtcaatatgtagtttaagagacaatcagtgtgtgtcttataaatggtacatctgtggtttttaatctgtgctagacttcaaaactgtgatctcctgttattgtatgcaaccttgaactccacctctgcaggggttcttctgtgattaaataggttataattataagcaaaattcagagcaactgagtactgatctaaaaagattacctttggctggaggtgagctgcactgaaactttacgacaaaatgtctctggacaaagagagtcagagaagagaagcaaaaggacactaattcatctgtaatttactgttggtaagcctagcagtaaagagacattggtcaattgctctgaccctgatgaattattaaactgagatcattgtcgtttatgcttgcagatgttaaatggaaaagttatatatgcataaaccttttcttcctggatttggcagatatgtataattatattaaaatggttctagcacaacattgggtccagtttaattttacaccgctatttatgaataagaagcctacattcagcctttcctccccaaaacacgtttttcttaggacagagagtaaattagcaaacttatttttactttttttttttgctaatctatgcataaaatagatatgaatgacagtggtaggtagactttttgtgactttcatcaggattgctctgaaattgagtttggagagcctaacaacaagatcttgttttccttgcttttccctccctacttcaaacctgaacgatttcttaggcactttattagaatgttttaaaatatatcaagtttttaagagggaggaggagaattggagtatctctgaaaacatgagaatgacaagaatttcttgttactattctcttatttgattaaggggattttttttttttaacttccaaaaactgaggtaaacatgagagggagtgtaatcagaatctgaaagtaattcaggcagaaatgattcctgaacaaaagagtttcagaaaagttttaaaacctataatttcagtagttgaacataaggcaccctggtcagtttgtgtgtatgtgtttaagaaagtgccgagggggaaaaaatgggtcccttttcagttgtacctgcattttgtaaaccagtcaccagaaaagacaaatgggccaatgatcatggtgctcctcaggtaaaagcaatatttaatttcattttaagctgcttaagctcttacagctgaccaaaattaagtgactcttgattgtaacgttttaaatgaaggttagcagttgcaacca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]