GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:24:38, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001270524            3140 bp    mRNA    linear   PRI 21-JAN-2020
DEFINITION  Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 4,
            mRNA.
ACCESSION   NM_001270524
VERSION     NM_001270524.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3140)
  AUTHORS   Figueira Muoio VM, Uno M, Oba-Shinjo S, da Silva R, Araujo Pereira
            BJ, Clara C, Matushita H and Marie SNK.
  TITLE     OTX1 and OTX2 Genes in Medulloblastoma
  JOURNAL   World Neurosurg 127, e58-e64 (2019)
   PUBMED   30797919
  REMARK    GeneRIF: The OTX2 gene was expressed in 62% of 60 Brazilian
            medulloblastoma patients. Expression varied with age (higher in
            younger age groups), location (predominantly vermis), and
            histological type (classic and anaplastic). A statistical
            correlation between OTX2 gene expression and the development of
            leptomeningeal metastases was observed.
            Erratum:[World Neurosurg. 2019 Oct;130:377. PMID: 31421436]
REFERENCE   2  (bases 1 to 3140)
  AUTHORS   Sakai A and Sugiyama S.
  TITLE     Experience-dependent transcriptional regulation in juvenile brain
            development
  JOURNAL   Dev. Growth Differ. 60 (8), 473-482 (2018)
   PUBMED   30368782
  REMARK    GeneRIF: It identified downstream targets of Otx2 suggest novel
            roles of Otx2 in homeostasis of PV cells, and, moreover, in
            regulation of chromatin state, which is important for neuronal
            plasticity.
            Review article
REFERENCE   3  (bases 1 to 3140)
  AUTHORS   Kaufman J, Wymbs NF, Montalvo-Ortiz JL, Orr C, Albaugh MD, Althoff
            R, O'Loughlin K, Holbrook H, Garavan H, Kearney C, Yang BZ, Zhao H,
            Pena C, Nestler EJ, Lee RS, Mostofsky S, Gelernter J and Hudziak J.
  TITLE     Methylation in OTX2 and related genes, maltreatment, and depression
            in children
  JOURNAL   Neuropsychopharmacology 43 (11), 2204-2211 (2018)
   PUBMED   30089883
  REMARK    GeneRIF: Maltreatment history and DNA methylation in OTX2
            significantly predicted depression in children.
REFERENCE   4  (bases 1 to 3140)
  AUTHORS   Su Z, Zhang Y, Liao B, Zhong X, Chen X, Wang H, Guo Y, Shan Y, Wang
            L and Pan G.
  TITLE     Antagonism between the transcription factors NANOG and OTX2
            specifies rostral or caudal cell fate during neural patterning
            transition
  JOURNAL   J. Biol. Chem. 293 (12), 4445-4455 (2018)
   PUBMED   29386354
  REMARK    GeneRIF: have uncovered a mutual antagonism between NANOG and OTX2
            underlying cell fate decisions during neural patterning, critical
            for the regulation of early neural development in humans
REFERENCE   5  (bases 1 to 3140)
  AUTHORS   Fong SL and Fong WB.
  TITLE     Elements regulating the transcription of human interstitial
            retinoid-binding protein (IRBP) gene in cultured retinoblastoma
            cells
  JOURNAL   Curr. Eye Res. 18 (4), 283-291 (1999)
   PUBMED   10372988
REFERENCE   6  (bases 1 to 3140)
  AUTHORS   Bobola N, Briata P, Ilengo C, Rosatto N, Craft C, Corte G and
            Ravazzolo R.
  TITLE     OTX2 homeodomain protein binds a DNA element necessary for
            interphotoreceptor retinoid binding protein gene expression
  JOURNAL   Mech. Dev. 82 (1-2), 165-169 (1999)
   PUBMED   10354480
REFERENCE   7  (bases 1 to 3140)
  AUTHORS   Nagao T, Leuzinger S, Acampora D, Simeone A, Finkelstein R,
            Reichert H and Furukubo-Tokunaga K.
  TITLE     Developmental rescue of Drosophila cephalic defects by the human
            Otx genes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 95 (7), 3737-3742 (1998)
   PUBMED   9520436
REFERENCE   8  (bases 1 to 3140)
  AUTHORS   Kastury K, Druck T, Huebner K, Barletta C, Acampora D, Simeone A,
            Faiella A and Boncinelli E.
  TITLE     Chromosome locations of human EMX and OTX genes
  JOURNAL   Genomics 22 (1), 41-45 (1994)
   PUBMED   7959790
REFERENCE   9  (bases 1 to 3140)
  AUTHORS   Kumaran,N., Pennesi,M.E., Yang,P., Trzupek,K.M., Schlechter,C.,
            Moore,A.T., Weleber,R.G. and Michaelides,M.
  TITLE     Leber Congenital Amaurosis / Early-Onset Severe Retinal Dystrophy
            Overview
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   30285347
REFERENCE   10 (bases 1 to 3140)
  AUTHORS   Bardakjian,T., Weiss,A. and Schneider,A.
  TITLE     Microphthalmia/Anophthalmia/Coloboma Spectrum
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   20301552
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL161757.4, AB593058.1,
            AK314271.1 and BC032579.1.
            On Jun 2, 2019 this sequence version replaced NM_001270524.1.
            
            Summary: This gene encodes a member of the bicoid subfamily of
            homeodomain-containing transcription factors. The encoded protein
            acts as a transcription factor and plays a role in brain,
            craniofacial, and sensory organ development. The encoded protein
            also influences the proliferation and differentiation of
            dopaminergic neuronal progenitor cells during mitosis. Mutations in
            this gene cause syndromic microphthalmia 5 (MCOPS5) and combined
            pituitary hormone deficiency 6 (CPHD6). This gene is also suspected
            of having an oncogenic role in medulloblastoma. Alternative
            splicing results in multiple transcript variants encoding distinct
            isoforms. Pseudogenes of this gene are known to exist on
            chromosomes two and nine. [provided by RefSeq, Jul 2012].
            
            Transcript Variant: This variant (4) differs in the 5' UTR and
            lacks an in-frame segment of the coding region, compared to variant
            1, and, compared to isoform a, encodes a shorter isoform (b).
            Variants 2-4 encode the same protein (isoform b).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1660809.67248.1,
                                           SRR1660807.17315.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03465402, SAMN03465403
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-3                 AL161757.4         55098-55100
            4-100               AB593058.1         1-97
            101-1310            AK314271.1         1-1210
            1311-2338           BC032579.1         1180-2207
            2339-3140           AL161757.4         64871-65672
FEATURES             Location/Qualifiers
     source          1..3140
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q22.3"
     gene            1..3140
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="orthodenticle homeobox 2"
                     /db_xref="GeneID:5015"
                     /db_xref="HGNC:HGNC:8522"
                     /db_xref="MIM:600037"
     exon            1..321
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       9
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1319288955"
     variation       16
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:922277261"
     variation       20
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1566628232"
     variation       22
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1039808944"
     variation       23
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:890444049"
     variation       23
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1386451269"
     variation       25
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:563987229"
     variation       26
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746287642"
     variation       31
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1050487280"
     variation       37
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:942960328"
     variation       40
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1225959412"
     variation       53
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1281912525"
     variation       63
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323335951"
     variation       70
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209714103"
     variation       71
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1286733573"
     variation       72
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:932028137"
     variation       83
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:535146235"
     variation       84
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566447220"
     variation       90
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978863581"
     variation       91
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200705423"
     variation       95
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773133418"
     variation       96
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:913295719"
     variation       99
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:941214420"
     variation       100
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138281551"
     variation       101
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185374570"
     variation       107
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1034347443"
     variation       108
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1368627464"
     variation       118
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:570520714"
     variation       120
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:541127366"
     variation       127
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:980550297"
     variation       130
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:192478552"
     variation       136
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1374327940"
     variation       145
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:969255897"
     variation       147
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1016870328"
     variation       148
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1240326648"
     variation       154
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1432249335"
     variation       156
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1281653929"
     variation       160
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1348904261"
     variation       163
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566628138"
     variation       169
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:908406083"
     variation       170
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1268414978"
     variation       174
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:571695883"
     variation       176
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1284852398"
     variation       177
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:12590685"
     variation       178..185
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ttttttt"
                     /replace="tttttttt"
                     /replace="ttttttttt"
                     /db_xref="dbSNP:980468035"
     variation       178
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:960692442"
     variation       179
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:559258863"
     variation       186
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1274519194"
     variation       187
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1025509029"
     variation       188
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1468394787"
     variation       198
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:550599732"
     variation       205
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:969095176"
     variation       206
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1341509276"
     variation       207
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1364975769"
     variation       211..227
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ggt"
                     /replace="ggtgaagactgcaaggt"
                     /db_xref="dbSNP:1331903564"
     variation       212
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1273173194"
     variation       214
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1334418804"
     variation       216
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1232733692"
     variation       217
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1308134595"
     variation       218
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1359754766"
     variation       225
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1247660725"
     variation       238
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355027027"
     variation       241
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1196365451"
     variation       243
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1285502586"
     variation       251
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1406529492"
     variation       252
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:900955099"
     variation       256
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1348444642"
     variation       258
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1307295522"
     variation       267
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150887670"
     variation       291
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1181907559"
     variation       303
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384758161"
     variation       314
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780689107"
     misc_feature    318..320
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="upstream in-frame stop codon"
     exon            322..537
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       340
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:867047559"
     variation       344
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463179835"
     variation       345
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1267978893"
     variation       349
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:566671671"
     variation       359
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:540831263"
     variation       375
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196562062"
     variation       376
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056716757"
     variation       377
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1015703211"
     variation       382
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1473067950"
     variation       383
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161674671"
     variation       390
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:546858272"
     variation       391
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747816534"
     variation       394
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776104541"
     variation       395
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200002729"
     variation       396
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326480147"
     variation       397
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373972732"
     variation       398
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564618315"
     variation       399..403
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1566625502"
     variation       399
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1312165040"
     variation       400
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779606022"
     variation       403
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758339288"
     variation       404
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1173169407"
     variation       406
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:905188703"
     variation       408
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:546311189"
     variation       412
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370535121"
     variation       414
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757069643"
     variation       420
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754146678"
     variation       421
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209340201"
     variation       423
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1486905888"
     variation       424
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764157150"
     variation       431
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1230570861"
     variation       432
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756345000"
     variation       433
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1349359874"
     variation       434
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752785578"
     variation       435
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1051054473"
     CDS             441..1310
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="isoform b is encoded by transcript variant 4;
                     homeobox protein OTX2; orthodenticle homolog 2"
                     /codon_start=1
                     /product="homeobox protein OTX2 isoform b"
                     /protein_id="NP_001257453.1"
                     /db_xref="CCDS:CCDS41960.1"
                     /db_xref="GeneID:5015"
                     /db_xref="HGNC:HGNC:8522"
                     /db_xref="MIM:600037"
                     /translation="
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL"
     misc_feature    order(555..569,573..575,624..626,642..644,681..683,
                     687..692,699..704,708..716,720..722)
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(561..563,570..572,690..692,699..704,711..713)
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    564..722
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:333795"
     misc_feature    897..1142
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="Otx1 transcription factor; Region: TF_Otx;
                     pfam03529"
                     /db_xref="CDD:308893"
     variation       442
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350877109"
     variation       444
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767603643"
     variation       445
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412709573"
     variation       449
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:575736431"
     variation       455
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752010967"
     variation       463
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1400172157"
     variation       464
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382934738"
     variation       465
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766756721"
     variation       470
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997349229"
     variation       471
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763234678"
     variation       473
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1186172721"
     variation       478
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776356711"
     variation       479
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768254721"
     variation       482
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760374061"
     variation       485
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946757953"
     variation       494
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1445883508"
     variation       497
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774907916"
     variation       498
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771687556"
     variation       501
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1207963480"
     variation       502
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745822138"
     variation       503
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:779418668"
     variation       504
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200680654"
     variation       506
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778956556"
     variation       509
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770855748"
     variation       516
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749151724"
     variation       518..521
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:786205874"
     variation       519
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259224286"
     variation       524
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1284677631"
     variation       525
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777618282"
     variation       529
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756331034"
     variation       535
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752941534"
     exon            538..689
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       538
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1449513107"
     variation       541..546
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:758119168"
     variation       541
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:758946986"
     variation       542
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750923926"
     variation       543
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374042850"
     variation       546
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1440715201"
     variation       557
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566624596"
     variation       559
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1555350405"
     variation       566
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246931412"
     variation       571
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203506236"
     variation       572
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1435887362"
     variation       578
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757602259"
     variation       583
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1229104622"
     variation       584
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354433789"
     variation       587
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347231732"
     variation       589..615
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="tagatgtgctggaagcactgtttgcca"
                     /db_xref="dbSNP:886044145"
     variation       592
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:567955379"
     variation       603
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368759331"
     variation       607..609
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gg"
                     /replace="tgt"
                     /db_xref="dbSNP:1555350397"
     variation       607
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1368488675"
     variation       608
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141664597"
     variation       619
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759256101"
     variation       620
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774043425"
     variation       623
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765964221"
     variation       627
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1064795810"
     variation       629
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762821214"
     variation       632
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867835552"
     variation       634
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1374187856"
     variation       642
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773157352"
     variation       651
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1434432414"
     variation       659..676
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ga"
                     /replace="gaaaatcaacttgcccga"
                     /db_xref="dbSNP:1566624472"
     variation       662
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1390373654"
     variation       674
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769477143"
     variation       675
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:786205224"
     variation       680
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376651816"
     variation       686
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747916036"
     exon            690..3140
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       690
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397190102"
     variation       705
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:104894464"
     variation       706
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200990681"
     variation       710
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1566623392"
     variation       712
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1555350254"
     variation       721
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:990697953"
     variation       723..742
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="caacaacagca"
                     /replace="caacaacagcaacaacagca"
                     /db_xref="dbSNP:1432265442"
     variation       723
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78953717"
     variation       725
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749788509"
     variation       732
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:786205884"
     variation       743
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867373003"
     variation       744
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566623353"
     variation       746
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778304481"
     variation       752
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536495343"
     variation       757
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751258203"
     variation       766
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779696471"
     variation       767
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757971368"
     variation       768
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750013761"
     variation       769
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1421844456"
     variation       773
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958176763"
     variation       778
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764625033"
     variation       782
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761862286"
     variation       787
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753729345"
     variation       788
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763911822"
     variation       789
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760396081"
     variation       792
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:925178840"
     variation       793
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1267666192"
     variation       795
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775702810"
     variation       796
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199799627"
     variation       798
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867148217"
     variation       801
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1294096975"
     variation       802
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774537529"
     variation       804
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748205899"
     variation       808
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:970116042"
     variation       812
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749843466"
     variation       817
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778357805"
     variation       822
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770291855"
     variation       827
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772021946"
     variation       828
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74658806"
     variation       829
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:867304376"
     variation       834
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758106958"
     variation       837..842
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:1555350223"
     variation       837
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376333965"
     variation       839
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372008404"
     variation       840
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753783256"
     variation       841
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199761861"
     variation       842..845
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ctct"
                     /replace="ctctct"
                     /db_xref="dbSNP:1566623121"
     variation       842
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:553884027"
     variation       853
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:786205879"
     variation       857
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1018175216"
     variation       859
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201721391"
     variation       860
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147896150"
     variation       862
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771047348"
     variation       863
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763064579"
     variation       867
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770486100"
     variation       868
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748631596"
     variation       869
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777104497"
     variation       871
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768857621"
     variation       872
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325619239"
     variation       874
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040844433"
     variation       875
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34537598"
     variation       880
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200171280"
     variation       882
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1306099663"
     variation       893
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373798705"
     variation       898
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345597863"
     variation       899
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538192166"
     variation       903..904
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gc"
                     /replace="gcgc"
                     /db_xref="dbSNP:786205873"
     variation       903
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173013598"
     variation       910
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:756087368"
     variation       920
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752526255"
     variation       930
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370354056"
     variation       935
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868464317"
     variation       937
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1224751397"
     variation       941
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767374937"
     variation       950
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:886043793"
     variation       956
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368033398"
     variation       959
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1184804231"
     variation       961
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566622915"
     variation       966
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751820068"
     variation       968
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:766762080"
     variation       969
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1209472542"
     variation       972
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344213875"
     variation       977
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:104894465"
     variation       983
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1257366193"
     variation       990
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773463323"
     variation       992
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1334931058"
     variation       994
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286159089"
     variation       996
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765382721"
     variation       997
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762435469"
     variation       1000
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776964451"
     variation       1002
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:397514463"
     variation       1003
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142205965"
     variation       1007
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747279627"
     variation       1008
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1173365017"
     variation       1013
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775913832"
     variation       1017
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748910557"
     variation       1018
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755578825"
     variation       1030
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473138354"
     variation       1031
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1216205714"
     variation       1032
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:907201088"
     variation       1040
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1196833377"
     variation       1049
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1257411968"
     variation       1057
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150982073"
     variation       1059
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780929725"
     variation       1062
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1470784217"
     variation       1071
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754929157"
     variation       1072
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751376563"
     variation       1074..1075
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ct"
                     /replace="g"
                     /db_xref="dbSNP:1566622642"
     variation       1077
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548455339"
     variation       1079
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142743327"
     variation       1080
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374968145"
     variation       1081
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1213822105"
     variation       1083
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419408753"
     variation       1084
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916022550"
     variation       1086..1089
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1566622571"
     variation       1089
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750626422"
     variation       1090
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:928898444"
     variation       1093
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765441049"
     variation       1095
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868121860"
     variation       1096
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761733794"
     variation       1098
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:529946021"
     variation       1099..1109
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gt"
                     /replace="gtcccatgggt"
                     /db_xref="dbSNP:745480462"
     variation       1100
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1281107964"
     variation       1107
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209058851"
     variation       1109
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764571884"
     variation       1114
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370761964"
     variation       1121
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775876318"
     variation       1129
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144449264"
     variation       1131
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772782540"
     variation       1136
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1330502209"
     variation       1140
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769304167"
     variation       1144
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1006268708"
     variation       1147
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747665958"
     variation       1150
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868295626"
     variation       1155
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143131956"
     variation       1159
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199650198"
     variation       1160
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1026307269"
     variation       1164
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768514532"
     variation       1165
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746941491"
     variation       1166
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1292858286"
     variation       1169
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210252921"
     variation       1170
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1555350163"
     variation       1173
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139800030"
     variation       1174
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758228717"
     variation       1180
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781096873"
     variation       1181
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:977939396"
     variation       1182
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1358330775"
     variation       1184
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1284735568"
     variation       1185
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993488539"
     variation       1186
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363170287"
     variation       1195..1200
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caacca"
                     /db_xref="dbSNP:1555350156"
     variation       1195
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322804815"
     variation       1198
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750679604"
     variation       1199
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1364445625"
     variation       1203
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867979918"
     variation       1208
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290281755"
     variation       1213
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:779220317"
     variation       1223
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1321908772"
     variation       1240
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1407465215"
     variation       1242
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1164601677"
     variation       1247
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78559885"
     variation       1256
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201396096"
     variation       1260
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:764205900"
     variation       1261
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:964796364"
     variation       1263
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1566622143"
     variation       1278
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017328977"
     variation       1282
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761138937"
     variation       1288
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753156713"
     variation       1289
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759833842"
     variation       1297
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774680300"
     variation       1301
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1219049095"
     variation       1312
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370275924"
     variation       1315
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776053080"
     variation       1316
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204435968"
     variation       1320
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:171978"
     variation       1321
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340168757"
     variation       1327..1331
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tttt"
                     /replace="ttttt"
                     /replace="tttttt"
                     /db_xref="dbSNP:1197615289"
     variation       1329
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1299838408"
     variation       1330
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192883185"
     variation       1332
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:889592710"
     variation       1335
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229234977"
     variation       1336
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780072062"
     variation       1337
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273316573"
     variation       1338
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457686689"
     variation       1340
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772006682"
     variation       1344
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182392988"
     variation       1350
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1245381513"
     variation       1351
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3742576"
     variation       1352
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866064360"
     variation       1353
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:558072316"
     variation       1354..1356
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1566622028"
     variation       1354
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485650070"
     variation       1356
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757464106"
     variation       1361
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428446118"
     variation       1366
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993744729"
     variation       1368
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:907483952"
     variation       1385
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1329597774"
     variation       1389..1392
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1398080713"
     variation       1398
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1463821799"
     variation       1399
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465056084"
     variation       1412
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337262345"
     variation       1421
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1399289149"
     variation       1431
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:575988911"
     variation       1434
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:555242082"
     variation       1435
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:561466216"
     variation       1436
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750146313"
     variation       1442
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1190100508"
     variation       1445
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229755388"
     variation       1450
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:894481205"
     variation       1456
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543291377"
     variation       1457
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1478094910"
     variation       1462
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482490326"
     variation       1463
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:928301679"
     variation       1466
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:981657803"
     variation       1468
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1255131942"
     variation       1470
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75947588"
     variation       1473
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764880954"
     variation       1475
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195329294"
     variation       1483
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420874693"
     variation       1485
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477169612"
     variation       1488
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:916081360"
     variation       1489
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1360812788"
     variation       1507
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464414724"
     variation       1513
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:985397680"
     variation       1517
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:952150059"
     variation       1529
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050559"
     variation       1533
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1402106303"
     variation       1537
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026840321"
     variation       1538
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903692952"
     variation       1540
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224139958"
     variation       1558
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042235855"
     variation       1561
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:945281239"
     variation       1564
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:923213099"
     variation       1566..1573
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caaaagca"
                     /db_xref="dbSNP:976420913"
     variation       1571
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:553969803"
     variation       1572
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972142607"
     variation       1578
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:943019365"
     variation       1583
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538805998"
     variation       1584
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1487017770"
     variation       1587
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1218381719"
     variation       1591
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1260532137"
     variation       1600
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1487705519"
     variation       1602
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199472030"
     variation       1618
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1427268662"
     variation       1626
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142727455"
     variation       1631
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1219845536"
     variation       1647
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984556416"
     variation       1648
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951811707"
     variation       1649
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556614831"
     variation       1650
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:3215889"
     variation       1651
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:869122184"
     variation       1651
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1555350067"
     variation       1652
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889740596"
     variation       1655
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:537889967"
     variation       1660
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1281712076"
     variation       1663
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1028147110"
     variation       1666
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295354677"
     variation       1669
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567634820"
     variation       1676
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219167817"
     variation       1681
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1331775492"
     variation       1687
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:971574768"
     variation       1693
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1024531987"
     variation       1697
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372333803"
     variation       1698
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1013593016"
     variation       1707
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1011851024"
     variation       1714
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621702"
     variation       1718
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357328033"
     variation       1724
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175318513"
     variation       1727
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164324256"
     variation       1732
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566621689"
     variation       1734
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:778705827"
     variation       1736
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414498885"
     variation       1737
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761387465"
     variation       1744
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1052830345"
     variation       1746
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190556214"
     variation       1762
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:894436849"
     variation       1770
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1033466446"
     variation       1772
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1251091564"
     variation       1773
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934406906"
     variation       1781
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621652"
     variation       1790
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1441364759"
     variation       1800..1805
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgattg"
                     /db_xref="dbSNP:149455658"
     variation       1801
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369779296"
     variation       1810
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438677729"
     variation       1813
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903304073"
     variation       1819
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754230866"
     variation       1831
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1042182924"
     variation       1836
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1045463851"
     variation       1841
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435793143"
     variation       1847
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868860898"
     variation       1853
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948990605"
     variation       1854
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945186505"
     variation       1856
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379724611"
     variation       1866
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:916180198"
     variation       1870..1875
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caatca"
                     /db_xref="dbSNP:1179283220"
     variation       1875..1876
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:1482497443"
     variation       1876..1883
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gtgtgt"
                     /replace="gtgtgtgt"
                     /db_xref="dbSNP:886050558"
     variation       1876
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:901684336"
     variation       1883
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228539728"
     variation       1888
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291528909"
     variation       1891
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1319424226"
     variation       1892
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237362268"
     variation       1895
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251855513"
     variation       1905
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764392879"
     variation       1915..1918
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1176602266"
     variation       1925
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1211453769"
     variation       1927
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040254525"
     variation       1933..1936
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1486654604"
     variation       1933
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:984960530"
     variation       1939
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1283965626"
     variation       1940
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1411874833"
     variation       1943
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536571793"
     variation       1948
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1239590153"
     variation       1953
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:930784453"
     variation       1957
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050557"
     variation       1958
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:886050556"
     variation       1959
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972087134"
     variation       1960
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:966101197"
     variation       1963..1964
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1331182993"
     variation       1964
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984894491"
     variation       1977
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184421963"
     variation       1986
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1376736111"
     variation       1987
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56245644"
     variation       1990
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1376475442"
     variation       1991
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1227306464"
     variation       2000
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:986127085"
     variation       2001
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621429"
     variation       2002..2013
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ttataa"
                     /replace="ttataattataa"
                     /db_xref="dbSNP:971821568"
     variation       2004
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1319311232"
     variation       2007
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196710335"
     variation       2008
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:58246365"
     variation       2009
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1257294974"
     variation       2016
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448679301"
     variation       2024
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211938034"
     variation       2032
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192422162"
     variation       2039
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1472585406"
     variation       2052
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1028682339"
     variation       2074
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775857186"
     variation       2076
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295783908"
     variation       2077
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1024896852"
     variation       2088
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:957402368"
     variation       2089
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138197536"
     variation       2091
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:998603699"
     variation       2098
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332601359"
     variation       2112
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:906986413"
     variation       2114
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045412281"
     variation       2122
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1013022875"
     variation       2130..2133
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1298354320"
     variation       2132
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:187055500"
     variation       2138
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772253161"
     variation       2140
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1341863555"
     variation       2143
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216233957"
     variation       2153
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1422373370"
     variation       2168
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:549838567"
     variation       2208
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1345627274"
     variation       2220
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220796650"
     variation       2229
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:74517617"
     variation       2230
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:80140046"
     variation       2231
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78935901"
     variation       2232
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759551235"
     variation       2233..2237
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gt"
                     /replace="gtcgt"
                     /db_xref="dbSNP:1000175646"
     variation       2233
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1441567214"
     variation       2235
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781146554"
     variation       2236
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036526594"
     variation       2243
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886050555"
     variation       2244
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192998502"
     variation       2250
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430693238"
     variation       2268
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767628237"
     variation       2273
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1215947126"
     variation       2274
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944782027"
     variation       2275
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488676963"
     variation       2276
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:57390094"
     variation       2277
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967368837"
     variation       2281..2282
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1298489300"
     variation       2282
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:912005555"
     variation       2317
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:986130839"
     variation       2318
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184224534"
     variation       2326
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228720148"
     variation       2336
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020294698"
     variation       2338
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:998230048"
ORIGIN      
agcaaatctccctgagagcgggaccggcctcagctccaacacagcctccactgtgattaaaaataaaaattgctagagcagccctcactcgccacatctactttgtatgtattgcagaggggcccacgcgtgtttagaactctagccgccttcctcattttcgttctttaaaaaaaattttttttggttgtgtttgacttttcatggaagggtgaagactgcaaggtttctaactcaatactcttgatttcttttaggatagctggctatttggaatttaaaggatatttgactttttctaacctcccatgaggctgtaagttccactgctccaaacccacccaccaaggactctgaacctgtccaccccgggcgcatcaagatcttccagctgggtacccccgatttgggccgactttgcacctccaaacaaccttagcatgatgtcttatcttaagcaaccgccttacgcagtcaatgggctgagtctgaccacttcgggtatggacttgctgcacccctccgtgggctacccggccaccccccggaaacagcgccgggagaggacgacgttcactcgggcgcagctagatgtgctggaagcactgtttgccaagacccggtacccagacatcttcatgcgagaggaggtggcactgaaaatcaacttgcccgagtcgagggtgcaggtatggtttaagaatcgaagagctaagtgccgccaacaacagcaacaacagcagaatggaggtcaaaacaaagtgagacctgccaaaaagaagacatctccagctcgggaagtgagttcagagagtggaacaagtggccaattcactcccccctctagcacctcagtcccgaccattgccagcagcagtgctcctgtgtctatctggagcccagcttccatctccccactgtcagatcccttgtccacctcctcttcctgcatgcagaggtcctatcccatgacctatactcaggcttcaggttatagtcaaggatatgctggctcaacttcctactttgggggcatggactgtggatcatatttgacccctatgcatcaccagcttcccggaccaggggccacactcagtcccatgggtaccaatgcagtcaccagccatctcaatcagtccccagcttctctttccacccagggatatggagcttcaagcttgggttttaactcaaccactgattgcttggattataaggaccaaactgcctcctggaagcttaacttcaatgctgactgcttggattataaagatcagacatcctcgtggaaattccaggttttgtgaagacctgtagaacctctttttgtgggtgatttttaaatatactgggctggacattccagttttagccaggcattggttaaaagagttagatgggatgatgctcagactcatctgatcaaagttccgagaggcatagaaggaaaaacgaagggccttagaggggcctacaaaccagcaacatgaaatggacaaaccaatctgcttaagatcctgtcatagttttagatcattggttatcctgatttgcaaagtgatcaaaagcattctagccatgtgcaaccaaacaccaccaaaaataaaatcaaacaaaactaagttgtgaaggaagggagggaaggtcatagccttcttaagcagaggtgttccattgttttagccaatccttggttgaatcttaggaatgaacagtgtctcaagctcattcacgtttcatgaccaactggtagttggcactgaaaaaacttttcagggctgtgtgaattgtgtgactgattgtcctagatgcactactttatttaaaaaataatgttcataaggagtcaatatgtagtttaagagacaatcagtgtgtgtcttataaatggtacatctgtggtttttaatctgtgctagacttcaaaactgtgatctcctgttattgtatgcaaccttgaactccacctctgcaggggttcttctgtgattaaataggttataattataagcaaaattcagagcaactgagtactgatctaaaaagattacctttggctggaggtgagctgcactgaaactttacgacaaaatgtctctggacaaagagagtcagagaagagaagcaaaaggacactaattcatctgtaatttactgttggtaagcctagcagtaaagagacattggtcaattgctctgaccctgatgaattattaaactgagatcattgtcgtttatgcttgcagatgttaaatggaaaagttatatatgcataaaccttttcttcctggatttggcagatatgtataattatattaaaatggttctagcacaacattgggtccagtttaattttacaccgctatttatgaataagaagcctacattcagcctttcctccccaaaacacgtttttcttaggacagagagtaaattagcaaacttatttttactttttttttttgctaatctatgcataaaatagatatgaatgacagtggtaggtagactttttgtgactttcatcaggattgctctgaaattgagtttggagagcctaacaacaagatcttgttttccttgcttttccctccctacttcaaacctgaacgatttcttaggcactttattagaatgttttaaaatatatcaagtttttaagagggaggaggagaattggagtatctctgaaaacatgagaatgacaagaatttcttgttactattctcttatttgattaaggggattttttttttttaacttccaaaaactgaggtaaacatgagagggagtgtaatcagaatctgaaagtaattcaggcagaaatgattcctgaacaaaagagtttcagaaaagttttaaaacctataatttcagtagttgaacataaggcaccctggtcagtttgtgtgtatgtgtttaagaaagtgccgagggggaaaaaatgggtcccttttcagttgtacctgcattttgtaaaccagtcaccagaaaagacaaatgggccaatgatcatggtgctcctcaggtaaaagcaatatttaatttcattttaagctgcttaagctcttacagctgaccaaaattaagtgactcttgattgtaacgttttaaatgaaggttagcagttgcaacca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]