GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 23:19:01, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001270523            2987 bp    mRNA    linear   PRI 21-JAN-2020
DEFINITION  Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 3,
            mRNA.
ACCESSION   NM_001270523
VERSION     NM_001270523.2
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2987)
  AUTHORS   Figueira Muoio VM, Uno M, Oba-Shinjo S, da Silva R, Araujo Pereira
            BJ, Clara C, Matushita H and Marie SNK.
  TITLE     OTX1 and OTX2 Genes in Medulloblastoma
  JOURNAL   World Neurosurg 127, e58-e64 (2019)
   PUBMED   30797919
  REMARK    GeneRIF: The OTX2 gene was expressed in 62% of 60 Brazilian
            medulloblastoma patients. Expression varied with age (higher in
            younger age groups), location (predominantly vermis), and
            histological type (classic and anaplastic). A statistical
            correlation between OTX2 gene expression and the development of
            leptomeningeal metastases was observed.
            Erratum:[World Neurosurg. 2019 Oct;130:377. PMID: 31421436]
REFERENCE   2  (bases 1 to 2987)
  AUTHORS   Sakai A and Sugiyama S.
  TITLE     Experience-dependent transcriptional regulation in juvenile brain
            development
  JOURNAL   Dev. Growth Differ. 60 (8), 473-482 (2018)
   PUBMED   30368782
  REMARK    GeneRIF: It identified downstream targets of Otx2 suggest novel
            roles of Otx2 in homeostasis of PV cells, and, moreover, in
            regulation of chromatin state, which is important for neuronal
            plasticity.
            Review article
REFERENCE   3  (bases 1 to 2987)
  AUTHORS   Kaufman J, Wymbs NF, Montalvo-Ortiz JL, Orr C, Albaugh MD, Althoff
            R, O'Loughlin K, Holbrook H, Garavan H, Kearney C, Yang BZ, Zhao H,
            Pena C, Nestler EJ, Lee RS, Mostofsky S, Gelernter J and Hudziak J.
  TITLE     Methylation in OTX2 and related genes, maltreatment, and depression
            in children
  JOURNAL   Neuropsychopharmacology 43 (11), 2204-2211 (2018)
   PUBMED   30089883
  REMARK    GeneRIF: Maltreatment history and DNA methylation in OTX2
            significantly predicted depression in children.
REFERENCE   4  (bases 1 to 2987)
  AUTHORS   Su Z, Zhang Y, Liao B, Zhong X, Chen X, Wang H, Guo Y, Shan Y, Wang
            L and Pan G.
  TITLE     Antagonism between the transcription factors NANOG and OTX2
            specifies rostral or caudal cell fate during neural patterning
            transition
  JOURNAL   J. Biol. Chem. 293 (12), 4445-4455 (2018)
   PUBMED   29386354
  REMARK    GeneRIF: have uncovered a mutual antagonism between NANOG and OTX2
            underlying cell fate decisions during neural patterning, critical
            for the regulation of early neural development in humans
REFERENCE   5  (bases 1 to 2987)
  AUTHORS   Fong SL and Fong WB.
  TITLE     Elements regulating the transcription of human interstitial
            retinoid-binding protein (IRBP) gene in cultured retinoblastoma
            cells
  JOURNAL   Curr. Eye Res. 18 (4), 283-291 (1999)
   PUBMED   10372988
REFERENCE   6  (bases 1 to 2987)
  AUTHORS   Bobola N, Briata P, Ilengo C, Rosatto N, Craft C, Corte G and
            Ravazzolo R.
  TITLE     OTX2 homeodomain protein binds a DNA element necessary for
            interphotoreceptor retinoid binding protein gene expression
  JOURNAL   Mech. Dev. 82 (1-2), 165-169 (1999)
   PUBMED   10354480
REFERENCE   7  (bases 1 to 2987)
  AUTHORS   Nagao T, Leuzinger S, Acampora D, Simeone A, Finkelstein R,
            Reichert H and Furukubo-Tokunaga K.
  TITLE     Developmental rescue of Drosophila cephalic defects by the human
            Otx genes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 95 (7), 3737-3742 (1998)
   PUBMED   9520436
REFERENCE   8  (bases 1 to 2987)
  AUTHORS   Kastury K, Druck T, Huebner K, Barletta C, Acampora D, Simeone A,
            Faiella A and Boncinelli E.
  TITLE     Chromosome locations of human EMX and OTX genes
  JOURNAL   Genomics 22 (1), 41-45 (1994)
   PUBMED   7959790
REFERENCE   9  (bases 1 to 2987)
  AUTHORS   Kumaran,N., Pennesi,M.E., Yang,P., Trzupek,K.M., Schlechter,C.,
            Moore,A.T., Weleber,R.G. and Michaelides,M.
  TITLE     Leber Congenital Amaurosis / Early-Onset Severe Retinal Dystrophy
            Overview
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   30285347
REFERENCE   10 (bases 1 to 2987)
  AUTHORS   Bardakjian,T., Weiss,A. and Schneider,A.
  TITLE     Microphthalmia/Anophthalmia/Coloboma Spectrum
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   20301552
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL161757.4, AB593058.1,
            CV812961.1 and BC032579.1.
            On Jun 2, 2019 this sequence version replaced NM_001270523.1.
            
            Summary: This gene encodes a member of the bicoid subfamily of
            homeodomain-containing transcription factors. The encoded protein
            acts as a transcription factor and plays a role in brain,
            craniofacial, and sensory organ development. The encoded protein
            also influences the proliferation and differentiation of
            dopaminergic neuronal progenitor cells during mitosis. Mutations in
            this gene cause syndromic microphthalmia 5 (MCOPS5) and combined
            pituitary hormone deficiency 6 (CPHD6). This gene is also suspected
            of having an oncogenic role in medulloblastoma. Alternative
            splicing results in multiple transcript variants encoding distinct
            isoforms. Pseudogenes of this gene are known to exist on
            chromosomes two and nine. [provided by RefSeq, Jul 2012].
            
            Transcript Variant: This variant (3) lacks an in-frame segment of
            the coding region, compared to variant 1, and, compared to isoform
            a, encodes a shorter isoform (b). Variants 2-4 encode the same
            protein (isoform b).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1803611.183823.1,
                                           SRR1803615.116004.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03465402, SAMN03465403
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-3                 AL161757.4         55098-55100
            4-26                AB593058.1         1-23
            27-743              CV812961.1         1-717
            744-2185            BC032579.1         766-2207
            2186-2987           AL161757.4         64871-65672
FEATURES             Location/Qualifiers
     source          1..2987
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q22.3"
     gene            1..2987
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="orthodenticle homeobox 2"
                     /db_xref="GeneID:5015"
                     /db_xref="HGNC:HGNC:8522"
                     /db_xref="MIM:600037"
     exon            1..104
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       9
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1319288955"
     variation       16
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:922277261"
     variation       20
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1566628232"
     variation       22
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1039808944"
     variation       23
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:890444049"
     variation       23
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1386451269"
     variation       25
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:563987229"
     variation       26
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746287642"
     variation       31
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1050487280"
     variation       37
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:942960328"
     variation       40
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1225959412"
     variation       53
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1281912525"
     variation       63
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323335951"
     variation       70
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209714103"
     variation       71
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1286733573"
     variation       72
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:932028137"
     variation       83
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:535146235"
     variation       84
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566447220"
     variation       90
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978863581"
     variation       91
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200705423"
     variation       95
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773133418"
     variation       96
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:913295719"
     variation       99
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:941214420"
     variation       100
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138281551"
     variation       101
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185374570"
     exon            105..168
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       105
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1307295522"
     variation       114
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150887670"
     variation       138
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1181907559"
     variation       150
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384758161"
     variation       161
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780689107"
     misc_feature    165..167
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="upstream in-frame stop codon"
     exon            169..384
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       187
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:867047559"
     variation       191
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463179835"
     variation       192
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1267978893"
     variation       196
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:566671671"
     variation       206
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:540831263"
     variation       222
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196562062"
     variation       223
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056716757"
     variation       224
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1015703211"
     variation       229
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1473067950"
     variation       230
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161674671"
     variation       237
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:546858272"
     variation       238
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747816534"
     variation       241
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776104541"
     variation       242
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200002729"
     variation       243
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326480147"
     variation       244
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373972732"
     variation       245
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564618315"
     variation       246..250
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1566625502"
     variation       246
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1312165040"
     variation       247
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779606022"
     variation       250
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758339288"
     variation       251
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1173169407"
     variation       253
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:905188703"
     variation       255
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:546311189"
     variation       259
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370535121"
     variation       261
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757069643"
     variation       267
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754146678"
     variation       268
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209340201"
     variation       270
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1486905888"
     variation       271
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764157150"
     variation       278
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1230570861"
     variation       279
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756345000"
     variation       280
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1349359874"
     variation       281
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752785578"
     variation       282
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1051054473"
     CDS             288..1157
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="isoform b is encoded by transcript variant 3;
                     homeobox protein OTX2; orthodenticle homolog 2"
                     /codon_start=1
                     /product="homeobox protein OTX2 isoform b"
                     /protein_id="NP_001257452.1"
                     /db_xref="CCDS:CCDS41960.1"
                     /db_xref="GeneID:5015"
                     /db_xref="HGNC:HGNC:8522"
                     /db_xref="MIM:600037"
                     /translation="
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL"
     misc_feature    order(402..416,420..422,471..473,489..491,528..530,
                     534..539,546..551,555..563,567..569)
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(408..410,417..419,537..539,546..551,558..560)
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    411..569
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:333795"
     misc_feature    744..989
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="Otx1 transcription factor; Region: TF_Otx;
                     pfam03529"
                     /db_xref="CDD:308893"
     variation       289
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350877109"
     variation       291
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767603643"
     variation       292
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412709573"
     variation       296
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:575736431"
     variation       302
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752010967"
     variation       310
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1400172157"
     variation       311
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382934738"
     variation       312
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766756721"
     variation       317
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997349229"
     variation       318
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763234678"
     variation       320
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1186172721"
     variation       325
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776356711"
     variation       326
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768254721"
     variation       329
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760374061"
     variation       332
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946757953"
     variation       341
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1445883508"
     variation       344
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774907916"
     variation       345
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771687556"
     variation       348
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1207963480"
     variation       349
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745822138"
     variation       350
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:779418668"
     variation       351
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200680654"
     variation       353
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778956556"
     variation       356
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770855748"
     variation       363
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749151724"
     variation       365..368
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:786205874"
     variation       366
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259224286"
     variation       371
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1284677631"
     variation       372
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777618282"
     variation       376
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756331034"
     variation       382
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752941534"
     exon            385..536
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       385
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1449513107"
     variation       388..393
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:758119168"
     variation       388
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:758946986"
     variation       389
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750923926"
     variation       390
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374042850"
     variation       393
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1440715201"
     variation       404
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566624596"
     variation       406
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1555350405"
     variation       413
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246931412"
     variation       418
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203506236"
     variation       419
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1435887362"
     variation       425
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757602259"
     variation       430
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1229104622"
     variation       431
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354433789"
     variation       434
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347231732"
     variation       436..462
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="tagatgtgctggaagcactgtttgcca"
                     /db_xref="dbSNP:886044145"
     variation       439
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:567955379"
     variation       450
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368759331"
     variation       454..456
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gg"
                     /replace="tgt"
                     /db_xref="dbSNP:1555350397"
     variation       454
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1368488675"
     variation       455
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141664597"
     variation       466
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759256101"
     variation       467
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774043425"
     variation       470
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765964221"
     variation       474
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1064795810"
     variation       476
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762821214"
     variation       479
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867835552"
     variation       481
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1374187856"
     variation       489
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773157352"
     variation       498
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1434432414"
     variation       506..523
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ga"
                     /replace="gaaaatcaacttgcccga"
                     /db_xref="dbSNP:1566624472"
     variation       509
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1390373654"
     variation       521
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769477143"
     variation       522
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:786205224"
     variation       527
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376651816"
     variation       533
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747916036"
     exon            537..2987
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       537
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397190102"
     variation       552
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:104894464"
     variation       553
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200990681"
     variation       557
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1566623392"
     variation       559
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1555350254"
     variation       568
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:990697953"
     variation       570..589
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="caacaacagca"
                     /replace="caacaacagcaacaacagca"
                     /db_xref="dbSNP:1432265442"
     variation       570
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78953717"
     variation       572
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749788509"
     variation       579
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:786205884"
     variation       590
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867373003"
     variation       591
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566623353"
     variation       593
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778304481"
     variation       599
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536495343"
     variation       604
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751258203"
     variation       613
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779696471"
     variation       614
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757971368"
     variation       615
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750013761"
     variation       616
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1421844456"
     variation       620
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958176763"
     variation       625
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764625033"
     variation       629
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761862286"
     variation       634
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753729345"
     variation       635
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763911822"
     variation       636
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760396081"
     variation       639
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:925178840"
     variation       640
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1267666192"
     variation       642
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775702810"
     variation       643
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199799627"
     variation       645
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867148217"
     variation       648
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1294096975"
     variation       649
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774537529"
     variation       651
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748205899"
     variation       655
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:970116042"
     variation       659
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749843466"
     variation       664
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778357805"
     variation       669
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770291855"
     variation       674
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772021946"
     variation       675
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74658806"
     variation       676
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:867304376"
     variation       681
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758106958"
     variation       684..689
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:1555350223"
     variation       684
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376333965"
     variation       686
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372008404"
     variation       687
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753783256"
     variation       688
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199761861"
     variation       689..692
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ctct"
                     /replace="ctctct"
                     /db_xref="dbSNP:1566623121"
     variation       689
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:553884027"
     variation       700
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:786205879"
     variation       704
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1018175216"
     variation       706
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201721391"
     variation       707
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147896150"
     variation       709
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771047348"
     variation       710
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763064579"
     variation       714
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770486100"
     variation       715
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748631596"
     variation       716
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777104497"
     variation       718
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768857621"
     variation       719
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325619239"
     variation       721
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040844433"
     variation       722
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34537598"
     variation       727
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200171280"
     variation       729
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1306099663"
     variation       740
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373798705"
     variation       745
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345597863"
     variation       746
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538192166"
     variation       750..751
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gc"
                     /replace="gcgc"
                     /db_xref="dbSNP:786205873"
     variation       750
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173013598"
     variation       757
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:756087368"
     variation       767
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752526255"
     variation       777
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370354056"
     variation       782
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868464317"
     variation       784
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1224751397"
     variation       788
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767374937"
     variation       797
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:886043793"
     variation       803
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368033398"
     variation       806
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1184804231"
     variation       808
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566622915"
     variation       813
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751820068"
     variation       815
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:766762080"
     variation       816
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1209472542"
     variation       819
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344213875"
     variation       824
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:104894465"
     variation       830
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1257366193"
     variation       837
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773463323"
     variation       839
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1334931058"
     variation       841
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286159089"
     variation       843
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765382721"
     variation       844
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762435469"
     variation       847
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776964451"
     variation       849
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:397514463"
     variation       850
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142205965"
     variation       854
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747279627"
     variation       855
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1173365017"
     variation       860
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775913832"
     variation       864
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748910557"
     variation       865
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755578825"
     variation       877
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473138354"
     variation       878
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1216205714"
     variation       879
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:907201088"
     variation       887
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1196833377"
     variation       896
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1257411968"
     variation       904
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150982073"
     variation       906
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780929725"
     variation       909
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1470784217"
     variation       918
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754929157"
     variation       919
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751376563"
     variation       921..922
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ct"
                     /replace="g"
                     /db_xref="dbSNP:1566622642"
     variation       924
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548455339"
     variation       926
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142743327"
     variation       927
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374968145"
     variation       928
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1213822105"
     variation       930
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419408753"
     variation       931
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916022550"
     variation       933..936
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1566622571"
     variation       936
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750626422"
     variation       937
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:928898444"
     variation       940
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765441049"
     variation       942
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868121860"
     variation       943
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761733794"
     variation       945
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:529946021"
     variation       946..956
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gt"
                     /replace="gtcccatgggt"
                     /db_xref="dbSNP:745480462"
     variation       947
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1281107964"
     variation       954
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209058851"
     variation       956
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764571884"
     variation       961
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370761964"
     variation       968
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775876318"
     variation       976
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144449264"
     variation       978
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772782540"
     variation       983
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1330502209"
     variation       987
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769304167"
     variation       991
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1006268708"
     variation       994
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747665958"
     variation       997
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868295626"
     variation       1002
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143131956"
     variation       1006
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199650198"
     variation       1007
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1026307269"
     variation       1011
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768514532"
     variation       1012
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746941491"
     variation       1013
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1292858286"
     variation       1016
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210252921"
     variation       1017
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1555350163"
     variation       1020
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139800030"
     variation       1021
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758228717"
     variation       1027
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781096873"
     variation       1028
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:977939396"
     variation       1029
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1358330775"
     variation       1031
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1284735568"
     variation       1032
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993488539"
     variation       1033
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363170287"
     variation       1042..1047
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caacca"
                     /db_xref="dbSNP:1555350156"
     variation       1042
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322804815"
     variation       1045
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750679604"
     variation       1046
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1364445625"
     variation       1050
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867979918"
     variation       1055
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290281755"
     variation       1060
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:779220317"
     variation       1070
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1321908772"
     variation       1087
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1407465215"
     variation       1089
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1164601677"
     variation       1094
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78559885"
     variation       1103
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201396096"
     variation       1107
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:764205900"
     variation       1108
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:964796364"
     variation       1110
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1566622143"
     variation       1125
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017328977"
     variation       1129
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761138937"
     variation       1135
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753156713"
     variation       1136
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759833842"
     variation       1144
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774680300"
     variation       1148
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1219049095"
     variation       1159
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370275924"
     variation       1162
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776053080"
     variation       1163
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204435968"
     variation       1167
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:171978"
     variation       1168
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340168757"
     variation       1174..1178
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tttt"
                     /replace="ttttt"
                     /replace="tttttt"
                     /db_xref="dbSNP:1197615289"
     variation       1176
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1299838408"
     variation       1177
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192883185"
     variation       1179
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:889592710"
     variation       1182
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229234977"
     variation       1183
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780072062"
     variation       1184
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273316573"
     variation       1185
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457686689"
     variation       1187
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772006682"
     variation       1191
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182392988"
     variation       1197
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1245381513"
     variation       1198
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3742576"
     variation       1199
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866064360"
     variation       1200
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:558072316"
     variation       1201..1203
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1566622028"
     variation       1201
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485650070"
     variation       1203
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757464106"
     variation       1208
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428446118"
     variation       1213
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993744729"
     variation       1215
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:907483952"
     variation       1232
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1329597774"
     variation       1236..1239
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1398080713"
     variation       1245
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1463821799"
     variation       1246
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465056084"
     variation       1259
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337262345"
     variation       1268
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1399289149"
     variation       1278
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:575988911"
     variation       1281
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:555242082"
     variation       1282
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:561466216"
     variation       1283
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750146313"
     variation       1289
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1190100508"
     variation       1292
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229755388"
     variation       1297
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:894481205"
     variation       1303
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543291377"
     variation       1304
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1478094910"
     variation       1309
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482490326"
     variation       1310
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:928301679"
     variation       1313
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:981657803"
     variation       1315
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1255131942"
     variation       1317
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75947588"
     variation       1320
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764880954"
     variation       1322
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195329294"
     variation       1330
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420874693"
     variation       1332
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477169612"
     variation       1335
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:916081360"
     variation       1336
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1360812788"
     variation       1354
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464414724"
     variation       1360
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:985397680"
     variation       1364
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:952150059"
     variation       1376
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050559"
     variation       1380
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1402106303"
     variation       1384
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026840321"
     variation       1385
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903692952"
     variation       1387
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224139958"
     variation       1405
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042235855"
     variation       1408
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:945281239"
     variation       1411
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:923213099"
     variation       1413..1420
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caaaagca"
                     /db_xref="dbSNP:976420913"
     variation       1418
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:553969803"
     variation       1419
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972142607"
     variation       1425
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:943019365"
     variation       1430
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538805998"
     variation       1431
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1487017770"
     variation       1434
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1218381719"
     variation       1438
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1260532137"
     variation       1447
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1487705519"
     variation       1449
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199472030"
     variation       1465
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1427268662"
     variation       1473
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142727455"
     variation       1478
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1219845536"
     variation       1494
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984556416"
     variation       1495
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951811707"
     variation       1496
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556614831"
     variation       1497
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:3215889"
     variation       1498
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:869122184"
     variation       1498
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1555350067"
     variation       1499
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889740596"
     variation       1502
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:537889967"
     variation       1507
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1281712076"
     variation       1510
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1028147110"
     variation       1513
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295354677"
     variation       1516
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567634820"
     variation       1523
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219167817"
     variation       1528
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1331775492"
     variation       1534
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:971574768"
     variation       1540
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1024531987"
     variation       1544
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372333803"
     variation       1545
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1013593016"
     variation       1554
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1011851024"
     variation       1561
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621702"
     variation       1565
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357328033"
     variation       1571
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175318513"
     variation       1574
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164324256"
     variation       1579
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566621689"
     variation       1581
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:778705827"
     variation       1583
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414498885"
     variation       1584
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761387465"
     variation       1591
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1052830345"
     variation       1593
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190556214"
     variation       1609
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:894436849"
     variation       1617
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1033466446"
     variation       1619
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1251091564"
     variation       1620
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934406906"
     variation       1628
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621652"
     variation       1637
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1441364759"
     variation       1647..1652
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgattg"
                     /db_xref="dbSNP:149455658"
     variation       1648
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369779296"
     variation       1657
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438677729"
     variation       1660
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903304073"
     variation       1666
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754230866"
     variation       1678
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1042182924"
     variation       1683
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1045463851"
     variation       1688
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435793143"
     variation       1694
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868860898"
     variation       1700
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948990605"
     variation       1701
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945186505"
     variation       1703
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379724611"
     variation       1713
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:916180198"
     variation       1717..1722
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caatca"
                     /db_xref="dbSNP:1179283220"
     variation       1722..1723
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:1482497443"
     variation       1723..1730
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gtgtgt"
                     /replace="gtgtgtgt"
                     /db_xref="dbSNP:886050558"
     variation       1723
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:901684336"
     variation       1730
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228539728"
     variation       1735
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291528909"
     variation       1738
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1319424226"
     variation       1739
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237362268"
     variation       1742
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251855513"
     variation       1752
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764392879"
     variation       1762..1765
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1176602266"
     variation       1772
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1211453769"
     variation       1774
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040254525"
     variation       1780..1783
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1486654604"
     variation       1780
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:984960530"
     variation       1786
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1283965626"
     variation       1787
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1411874833"
     variation       1790
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536571793"
     variation       1795
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1239590153"
     variation       1800
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:930784453"
     variation       1804
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050557"
     variation       1805
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:886050556"
     variation       1806
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972087134"
     variation       1807
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:966101197"
     variation       1810..1811
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1331182993"
     variation       1811
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984894491"
     variation       1824
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184421963"
     variation       1833
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1376736111"
     variation       1834
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56245644"
     variation       1837
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1376475442"
     variation       1838
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1227306464"
     variation       1847
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:986127085"
     variation       1848
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621429"
     variation       1849..1860
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ttataa"
                     /replace="ttataattataa"
                     /db_xref="dbSNP:971821568"
     variation       1851
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1319311232"
     variation       1854
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196710335"
     variation       1855
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:58246365"
     variation       1856
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1257294974"
     variation       1863
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448679301"
     variation       1871
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211938034"
     variation       1879
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192422162"
     variation       1886
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1472585406"
     variation       1899
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1028682339"
     variation       1921
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775857186"
     variation       1923
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295783908"
     variation       1924
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1024896852"
     variation       1935
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:957402368"
     variation       1936
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138197536"
     variation       1938
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:998603699"
     variation       1945
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332601359"
     variation       1959
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:906986413"
     variation       1961
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045412281"
     variation       1969
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1013022875"
     variation       1977..1980
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1298354320"
     variation       1979
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:187055500"
     variation       1985
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772253161"
     variation       1987
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1341863555"
     variation       1990
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216233957"
     variation       2000
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1422373370"
     variation       2015
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:549838567"
     variation       2055
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1345627274"
     variation       2067
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220796650"
     variation       2076
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:74517617"
     variation       2077
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:80140046"
     variation       2078
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78935901"
     variation       2079
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759551235"
     variation       2080..2084
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gt"
                     /replace="gtcgt"
                     /db_xref="dbSNP:1000175646"
     variation       2080
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1441567214"
     variation       2082
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781146554"
     variation       2083
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036526594"
     variation       2090
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886050555"
     variation       2091
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192998502"
     variation       2097
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430693238"
     variation       2115
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767628237"
     variation       2120
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1215947126"
     variation       2121
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944782027"
     variation       2122
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488676963"
     variation       2123
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:57390094"
     variation       2124
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967368837"
     variation       2128..2129
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1298489300"
     variation       2129
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:912005555"
     variation       2164
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:986130839"
     variation       2165
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184224534"
     variation       2173
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228720148"
     variation       2183
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020294698"
     variation       2185
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:998230048"
ORIGIN      
agcaaatctccctgagagcgggaccggcctcagctccaacacagcctccactgtgattaaaaataaaaattgctagagcagccctcactcgccacatctactttgatagctggctatttggaatttaaaggatatttgactttttctaacctcccatgaggctgtaagttccactgctccaaacccacccaccaaggactctgaacctgtccaccccgggcgcatcaagatcttccagctgggtacccccgatttgggccgactttgcacctccaaacaaccttagcatgatgtcttatcttaagcaaccgccttacgcagtcaatgggctgagtctgaccacttcgggtatggacttgctgcacccctccgtgggctacccggccaccccccggaaacagcgccgggagaggacgacgttcactcgggcgcagctagatgtgctggaagcactgtttgccaagacccggtacccagacatcttcatgcgagaggaggtggcactgaaaatcaacttgcccgagtcgagggtgcaggtatggtttaagaatcgaagagctaagtgccgccaacaacagcaacaacagcagaatggaggtcaaaacaaagtgagacctgccaaaaagaagacatctccagctcgggaagtgagttcagagagtggaacaagtggccaattcactcccccctctagcacctcagtcccgaccattgccagcagcagtgctcctgtgtctatctggagcccagcttccatctccccactgtcagatcccttgtccacctcctcttcctgcatgcagaggtcctatcccatgacctatactcaggcttcaggttatagtcaaggatatgctggctcaacttcctactttgggggcatggactgtggatcatatttgacccctatgcatcaccagcttcccggaccaggggccacactcagtcccatgggtaccaatgcagtcaccagccatctcaatcagtccccagcttctctttccacccagggatatggagcttcaagcttgggttttaactcaaccactgattgcttggattataaggaccaaactgcctcctggaagcttaacttcaatgctgactgcttggattataaagatcagacatcctcgtggaaattccaggttttgtgaagacctgtagaacctctttttgtgggtgatttttaaatatactgggctggacattccagttttagccaggcattggttaaaagagttagatgggatgatgctcagactcatctgatcaaagttccgagaggcatagaaggaaaaacgaagggccttagaggggcctacaaaccagcaacatgaaatggacaaaccaatctgcttaagatcctgtcatagttttagatcattggttatcctgatttgcaaagtgatcaaaagcattctagccatgtgcaaccaaacaccaccaaaaataaaatcaaacaaaactaagttgtgaaggaagggagggaaggtcatagccttcttaagcagaggtgttccattgttttagccaatccttggttgaatcttaggaatgaacagtgtctcaagctcattcacgtttcatgaccaactggtagttggcactgaaaaaacttttcagggctgtgtgaattgtgtgactgattgtcctagatgcactactttatttaaaaaataatgttcataaggagtcaatatgtagtttaagagacaatcagtgtgtgtcttataaatggtacatctgtggtttttaatctgtgctagacttcaaaactgtgatctcctgttattgtatgcaaccttgaactccacctctgcaggggttcttctgtgattaaataggttataattataagcaaaattcagagcaactgagtactgatctaaaaagattacctttggctggaggtgagctgcactgaaactttacgacaaaatgtctctggacaaagagagtcagagaagagaagcaaaaggacactaattcatctgtaatttactgttggtaagcctagcagtaaagagacattggtcaattgctctgaccctgatgaattattaaactgagatcattgtcgtttatgcttgcagatgttaaatggaaaagttatatatgcataaaccttttcttcctggatttggcagatatgtataattatattaaaatggttctagcacaacattgggtccagtttaattttacaccgctatttatgaataagaagcctacattcagcctttcctccccaaaacacgtttttcttaggacagagagtaaattagcaaacttatttttactttttttttttgctaatctatgcataaaatagatatgaatgacagtggtaggtagactttttgtgactttcatcaggattgctctgaaattgagtttggagagcctaacaacaagatcttgttttccttgcttttccctccctacttcaaacctgaacgatttcttaggcactttattagaatgttttaaaatatatcaagtttttaagagggaggaggagaattggagtatctctgaaaacatgagaatgacaagaatttcttgttactattctcttatttgattaaggggattttttttttttaacttccaaaaactgaggtaaacatgagagggagtgtaatcagaatctgaaagtaattcaggcagaaatgattcctgaacaaaagagtttcagaaaagttttaaaacctataatttcagtagttgaacataaggcaccctggtcagtttgtgtgtatgtgtttaagaaagtgccgagggggaaaaaatgggtcccttttcagttgtacctgcattttgtaaaccagtcaccagaaaagacaaatgggccaatgatcatggtgctcctcaggtaaaagcaatatttaatttcattttaagctgcttaagctcttacagctgaccaaaattaagtgactcttgattgtaacgttttaaatgaaggttagcagttgcaacca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]