GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 10:32:56, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001251129            1515 bp    mRNA    linear   PLN 21-SEP-2019
DEFINITION  Glycine max homeobox protein SBH1 (H1), mRNA.
ACCESSION   NM_001251129
VERSION     NM_001251129.1
KEYWORDS    RefSeq.
SOURCE      Glycine max (soybean)
  ORGANISM  Glycine max
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; indigoferoid/millettioid clade;
            Phaseoleae; Glycine; Soja.
REFERENCE   1  (bases 1 to 1515)
  AUTHORS   Ma H, McMullen MD and Finer JJ.
  TITLE     Identification of a homeobox-containing gene with enhanced
            expression during soybean (Glycine max L.) somatic embryo
            development
  JOURNAL   Plant Mol. Biol. 24 (3), 465-473 (1994)
   PUBMED   7907232
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from L13663.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: L13663.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN02644805 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1515
                     /organism="Glycine max"
                     /mol_type="mRNA"
                     /db_xref="taxon:3847"
                     /chromosome="9"
                     /map="9"
     gene            1..1515
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /note="homeobox protein SBH1"
                     /db_xref="GeneID:547796"
     exon            1..593
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    141..143
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /note="upstream in-frame stop codon"
     CDS             156..1295
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /note="soybean homeobox-containing"
                     /codon_start=1
                     /product="homeobox protein SBH1"
                     /protein_id="NP_001238058.1"
                     /db_xref="GeneID:547796"
                     /translation="
MEGGSSSSNGTSYLLAFGENNSGGLCPMTMMPLVTSHHAGHHPINPSNNNNVNTNCLFIPNCSNSTGTPSIMLHNNHNNNKTDDDDNNNNTGLGYYFMESDHHHHHHGNNNNNGSSSSSSSSAVKAKIMAHPHYHRLLAAYVNCQKVGAPPEVVARLEEACASAATMAGGDAAAGSSCIGEDPALDQFMEAYCEMLTKYEQELSKPLKEAMLFLQRIECQFKNLTISSSDFASNEGGDRNGSSEEDVDLHNMIDPQAEDRDLKGQLLRKYSGYLGSLKQEFMKKRKKGKLPKEARQQLLEWWNRHYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRHWKPSEDMQFVVMDPSHPHYYMDNVLGNPFPMDLSHPML"
     misc_feature    522..641
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /note="KNOX1 domain; Region: KNOX1; pfam03790"
                     /db_xref="CDD:335475"
     misc_feature    687..830
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /note="KNOX2 domain; Region: KNOX2; pfam03791"
                     /db_xref="CDD:335476"
     misc_feature    936..1001
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /note="ELK domain; Region: ELK; pfam03789"
                     /db_xref="CDD:335474"
     misc_feature    1056..1175
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:310480"
     exon            594..849
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /inference="alignment:Splign:2.1.0"
     exon            850..1091
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /inference="alignment:Splign:2.1.0"
     exon            1092..1515
                     /gene="H1"
                     /gene_synonym="Sbh1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aataagagaattgtgtgtcgtgtttgtttttgtttggtttgttgtaaggttagctagtgagtattctacacaagggtggtggtagggcaaaaaggataagacagtgaatgtgtgtgtgtgtgtgtgtgtgtgtgtgttgttgacaagcaaaagctatggagggtggtagtagtagctctaatggcacttcttatctgttggcttttggagaaaacaacagtggtgggctatgcccaatgacgatgatgcctttggtgacttcccatcacgctggtcatcatccaataaatcctagtaataataataatgtaaacacaaactgtctcttcattcccaactgcagtaacagtactggaactccttctatcatgctccacaataatcacaacaacaacaaaactgatgatgatgataacaacaacaacactgggttagggtactatttcatggagagtgaccaccaccaccatcaccacggcaacaacaacaacaatggaagctcctcctcctcctcctcttctgctgtcaaggccaagatcatggctcatcctcactatcaccgtctcttggcagcttacgtcaattgtcagaaggttggggccccgcctgaagtggtggcaaggttagaagaagcatgtgcttctgcagcgacaatggctggtggtgatgcagcagctggatcaagctgcataggtgaagatccagctttggatcagttcatggaggcttactgtgagatgctcacaaagtatgagcaagaactctccaaacccttaaaggaagccatgctcttccttcaaaggatcgagtgccagttcaaaaatcttacaatttcttcctccgactttgctagcaatgagggtggtgataggaatggatcgtctgaagaggatgttgatctacacaacatgatagatccccaggcagaggacagggatttaaagggtcagcttttgcgcaagtatagcggatacttgggcagtctgaagcaagaattcatgaagaagaggaagaaaggaaagctacctaaagaagcaaggcaacaattacttgaatggtggaacagacattacaaatggccttacccatccgaatcccagaagctggctcttgcagagtcgacaggtctggatcagaagcaaatcaacaactggtttattaatcaaaggaaacggcactggaagccttcagaggacatgcagtttgtggtgatggatccaagccatccacactattacatggataatgttctaggcaatccatttcccatggatctttcccatcccatgctctagaaaattatccctcgtttgtgggctgctgataatagattcataaactcgtgctgtcacttattaaaaccttacaattattaatattaattaatatgcattctaagaaatcctagattgctatactataatatagtacgcaggtgtatcccttgctagctttttagacggtcctttgtgtggatcatctagttgaaggagttatgaataaataaaattccat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]