GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 18:48:06, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001246389            2383 bp    mRNA    linear   PRI 03-APR-2023
DEFINITION  Pan troglodytes proteasome 20S subunit beta 2 (PSMB2), mRNA.
ACCESSION   NM_001246389 XM_003307974 XM_003307975 XM_003307976 XM_003307977
            XM_003307978 XM_524662
VERSION     NM_001246389.1
KEYWORDS    RefSeq.
SOURCE      Pan troglodytes (chimpanzee)
  ORGANISM  Pan troglodytes
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Pan.
REFERENCE   1  (bases 1 to 2383)
  AUTHORS   Kim RN, Kim DW, Choi SH, Chae SH, Nam SH, Kim DW, Kim A, Kang A,
            Park KH, Lee YS, Hirai M, Suzuki Y, Sugano S, Hashimoto K, Kim DS
            and Park HS.
  TITLE     Major chimpanzee-specific structural changes in sperm
            development-associated genes
  JOURNAL   Funct. Integr. Genomics 11 (3), 507-517 (2011)
   PUBMED   21484476
REFERENCE   2  (bases 1 to 2383)
  AUTHORS   Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B,
            Yusuf S, Gerstein HC, Engert JC and Anand S.
  CONSRTM   DREAM investigators
  TITLE     Variation at the NFATC2 locus increases the risk of
            thiazolidinedione-induced edema in the Diabetes REduction
            Assessment with ramipril and rosiglitazone Medication (DREAM) study
  JOURNAL   Diabetes Care 33 (10), 2250-2253 (2010)
   PUBMED   20628086
  REMARK    GeneRIF: Observational study of gene-disease association,
            gene-environment interaction, and pharmacogenomic / toxicogenomic.
            (HuGE Navigator)
REFERENCE   3  (bases 1 to 2383)
  AUTHORS   Talmud PJ, Drenos F, Shah S, Shah T, Palmen J, Verzilli C, Gaunt
            TR, Pallas J, Lovering R, Li K, Casas JP, Sofat R, Kumari M,
            Rodriguez S, Johnson T, Newhouse SJ, Dominiczak A, Samani NJ,
            Caulfield M, Sever P, Stanton A, Shields DC, Padmanabhan S,
            Melander O, Hastie C, Delles C, Ebrahim S, Marmot MG, Smith GD,
            Lawlor DA, Munroe PB, Day IN, Kivimaki M, Whittaker J, Humphries SE
            and Hingorani AD.
  CONSRTM   ASCOT investigators; NORDIL investigators; BRIGHT Consortium
  TITLE     Gene-centric association signals for lipids and apolipoproteins
            identified via the HumanCVD BeadChip
  JOURNAL   Am. J. Hum. Genet. 85 (5), 628-642 (2009)
   PUBMED   19913121
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AK306243.1.
            
            On or before Oct 10, 2011 this sequence version replaced
            XM_003307974.1, XM_003307975.1, XM_003307976.1, XM_524662.3,
            XM_003307977.1, XM_003307978.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK306243.1, SRR6713217.14134.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03735000 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2383
                     /organism="Pan troglodytes"
                     /mol_type="mRNA"
                     /db_xref="taxon:9598"
                     /chromosome="1"
                     /map="1"
     gene            1..2383
                     /gene="PSMB2"
                     /note="proteasome 20S subunit beta 2"
                     /db_xref="GeneID:469277"
                     /db_xref="VGNC:VGNC:11806"
     exon            1..171
                     /gene="PSMB2"
                     /inference="alignment:Splign:2.1.0"
     CDS             81..686
                     /gene="PSMB2"
                     /EC_number="3.4.25.1"
                     /note="proteasome beta 2 subunit; proteasome subunit beta
                     type 2; proteasome (prosome, macropain) subunit, beta
                     type, 2; proteasome subunit beta 2"
                     /codon_start=1
                     /product="proteasome subunit beta type-2"
                     /protein_id="NP_001233318.1"
                     /db_xref="GeneID:469277"
                     /db_xref="VGNC:VGNC:11806"
                     /translation="
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS"
     misc_feature    81..656
                     /gene="PSMB2"
                     /note="proteasome beta type-2 subunit. The 20S proteasome,
                     multisubunit proteolytic complex, is the central enzyme of
                     nonlysosomal protein degradation in both the cytosol and
                     nucleus. It is composed of 28 subunits arranged as four
                     homoheptameric rings that...; Region:
                     proteasome_beta_type_2; cd03758"
                     /db_xref="CDD:239727"
     exon            172..294
                     /gene="PSMB2"
                     /inference="alignment:Splign:2.1.0"
     exon            295..365
                     /gene="PSMB2"
                     /inference="alignment:Splign:2.1.0"
     exon            366..528
                     /gene="PSMB2"
                     /inference="alignment:Splign:2.1.0"
     exon            529..578
                     /gene="PSMB2"
                     /inference="alignment:Splign:2.1.0"
     exon            579..2368
                     /gene="PSMB2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ggtgctgtctcaccggtgagacctggaagcgggcgagtctcgcgctgtgtcggacctgcagcccctggccttccgccaccatggagtacctcattggtatccaaggccccgactatgttcttgtcgcctccgaccgggtggccgccagcaatattgtccagatgaaggacgatcatgacaagatgtttaagatgagtgaaaagatattactcctgtgtgttggagaggctggagacactgtacagtttgcagaatatattcagaaaaacgtgcaactttataagatgcgaaatggatatgaattgtctcccacggcagcagctaacttcacacgccgaaacctggctgactgtcttcggagtcggaccccatatcatgtgaacctcctcctggctggctatgatgagcatgaagggccagcgctgtattacatggactacctggcagccttggccaaggccccttttgcagcccacggctatggtgccttcctgactctcagtatcctcgaccgatactacacaccgactatctcacgtgagagggcggtggaactccttaggaaatgtctggaggagctccagaaacgcttcatcctgaatctgccaaccttcagtgttcgaatcattgacaaaaatggcatccatgacctggataacatttccttccccaaacagggctcctaacatcatgtcctccctcccacttgccagggaacttttttttgatgggctcctttatttttttctactcttttcaggtgcactcttgataaatggttaattcagaataaaggtgactatggatgtaattgggccctctggtccaggtctcagtttacctaatattacctcaaaaaggatatggagggaagatgatctttttgccaggtctgacttttcttcctgctccaccctccattaatgcttattacctttaacaactgacggccccacgttctactccatgcttggcttcctttccaactagctctttcatatattttacttgctagtatctccattctctctaaagtagtggttctttttgcccttaaacttaaatttttaaattaattaacctgaattaataatacatgcacttaatataacatgcaaacagtacaaaaacatgtagtgaaaaatatttcttccagagccggggtggtggctcatacctgtaatcccagcactttgggaggccgaggcgggcggatcacaaggtcaagagagcgagaccatcctgaccaacatggtaaaaccccgtgtctaataaagatacaaaaattagctgggcttggtggcacgcacccctagtcccagctactggggaggctgaggcaggagaatcggtcggacccgggaggcagaagttgcagtgagcctagatcgcgccactgtactccagcatggcgacaaagtgagtacttcgtctcaaaaaacgccagaaaaatgtttcttccatccctataatccagtcatctgcttcctgcttcccttcctggaaagaaattctactactaatttcttatgttttttaagagatattctgttactgtgtaaagtatacatacatacagacacatgccccctttaaattttttagatttatttatttagagacggggtctcactctagcccaggctggagtgctgtggtgtagtcttggctcactgcaacctccgcctcctgggcccaagtgatcctcccatctcagcctcctgagtagctgggattacaggcgcacaccaccaatgcccagctagtttttgtgtttttcatagagacagggtctcaccatgtcattcaggttggtcttgaactcctgggctcaagcagtctgcctgccttggcttcccagtgctgggattacaggcgtgagccaccgtgcccggctaaaaagtatttttaatgttctgcatattgcttatttcacttaacactatattagagattgttttatatcagtacatatagatatgcttattcttgttgacagttgcataattttccattaaattgatgtatcatgggcagttaaccagttacccgttttactcttagcatacatttagggcacaatgtggatgttttgtggttaaagctattaaaacagtggttcttgaccagatgtgtgtttcagaatgttcatctcacatttccagttgctactgatgctgctggtctaggaaccacatatcaaaaccatttggtctccgactaagaataaaccctactttatccaattctgtgctcctcttaatatcatatacagataggtttttgttttgtctgtgattaaatgtatcatctaagatactacctactgatcataacgttcatattaaagtattgggttaacattagaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]