GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 02:35:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001200921             957 bp    mRNA    linear   VRT 04-MAY-2019
DEFINITION  Ictalurus punctatus claudin-4 (cld4), mRNA.
ACCESSION   NM_001200921
VERSION     NM_001200921.1
KEYWORDS    RefSeq.
SOURCE      Ictalurus punctatus (channel catfish)
  ORGANISM  Ictalurus punctatus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;
            Ictaluridae; Ictalurus.
REFERENCE   1  (bases 1 to 957)
  AUTHORS   Chen F, Lee Y, Jiang Y, Wang S, Peatman E, Abernathy J, Liu H, Liu
            S, Kucuktas H, Ke C and Liu Z.
  TITLE     Identification and characterization of full-length cDNAs in channel
            catfish (Ictalurus punctatus) and blue catfish (Ictalurus furcatus)
  JOURNAL   PLoS ONE 5 (7), e11546 (2010)
   PUBMED   20634964
  REMARK    Publication Status: Online-Only
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from GU589254.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: GU589254.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..957
                     /organism="Ictalurus punctatus"
                     /mol_type="mRNA"
                     /db_xref="taxon:7998"
                     /chromosome="18"
                     /map="18"
     gene            1..957
                     /gene="cld4"
                     /note="claudin-4"
                     /db_xref="GeneID:100528651"
     exon            1..942
                     /gene="cld4"
                     /inference="alignment:Splign:2.0.8"
     misc_feature    21..23
                     /gene="cld4"
                     /note="upstream in-frame stop codon"
     CDS             51..686
                     /gene="cld4"
                     /codon_start=1
                     /product="claudin-4"
                     /protein_id="NP_001187850.1"
                     /db_xref="GeneID:100528651"
                     /translation="
MVSQGLQILGVMLSMTGWLGTIITCALPMWRVTAFIGANIVTAQVIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARAMVIISIIVGIFGVLMAVIGGKCTNCMEDESAKAKACIVSGVIFLIAAFLILIPVSWSAQTLIRDFYNPLVLEAQRRELGACLYIGWGSAALLLLGGGLLCWNCPPKENQQYTAAKFAPARSFSPGMNYV"
     misc_feature    63..566
                     /gene="cld4"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
acatttccggaactatcccatgaagcactgattgcagactatccagaacaatggtatcccaaggcctccagatcctgggtgttatgctgtctatgacagggtggctggggacaatcattacctgtgctctgcctatgtggagagtgacggctttcattggagctaacattgtcacagcgcaggtcatctgggagggtttatggatgaactgtgtggttcagagtactggacagatgcagtgtaaggtctacgactccctgctggcccttcctcaagaccttcaagcggcccgagccatggtcatcatctccatcattgtgggcatctttggtgtgctaatggctgtgattggaggaaagtgtactaactgcatggaggatgaatcagcaaaagctaaagcttgcattgtctcaggggtgatctttcttattgctgccttcctcatcctaatacctgtgagttggtctgcccagacccttatcagggacttctacaaccccttggtgttagaagcccagcgtcgagagttaggagcttgcctgtatattggctggggttctgcggctctcctgctgctggggggagggctgctttgctggaattgccctccgaaggagaaccagcagtatacagcagccaaatttgcacctgctagatccttttccccagggatgaattatgtgtgagcaaaacggtgaatgtttccatgagaactctgaacaaaagtggattcatctaccatattaactatgtatctggaaaggcatgtatttcttttcttttgcgaccacgtatattttcctattacatgattacagatctttgataataatgagatggatgcttgttttaataaatgaatgtgaacaaattctgtacatggaaattcggtgattgaaaatctttttcatttgacattttgtaattaaaagtctgtgaaacggaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]