GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-01-24 06:12:13, GGRNA.v2 : RefSeq release 203 (Nov, 2020)

LOCUS       NM_001194564            1820 bp    mRNA    linear   PRI 11-JUL-2020
DEFINITION  Macaca mulatta claudin 4 (CLDN4), mRNA.
ACCESSION   NM_001194564 XM_001112477
VERSION     NM_001194564.3
KEYWORDS    RefSeq.
SOURCE      Macaca mulatta (Rhesus monkey)
  ORGANISM  Macaca mulatta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
REFERENCE   1  (bases 1 to 1820)
  AUTHORS   Yan G, Zhang G, Fang X, Zhang Y, Li C, Ling F, Cooper DN, Li Q, Li
            Y, van Gool AJ, Du H, Chen J, Chen R, Zhang P, Huang Z, Thompson
            JR, Meng Y, Bai Y, Wang J, Zhuo M, Wang T, Huang Y, Wei L, Li J,
            Wang Z, Hu H, Yang P, Le L, Stenson PD, Li B, Liu X, Ball EV, An N,
            Huang Q, Zhang Y, Fan W, Zhang X, Li Y, Wang W, Katze MG, Su B,
            Nielsen R, Yang H, Wang J, Wang X and Wang J.
  TITLE     Genome sequencing and comparison of two nonhuman primate animal
            models, the cynomolgus and Chinese rhesus macaques
  JOURNAL   Nat. Biotechnol. 29 (11), 1019-1023 (2011)
   PUBMED   22002653
  REMARK    Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            QNVO02000311.1.
            On Jun 20, 2019 this sequence version replaced NM_001194564.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript is intronless :: SRR3476739.265954.1, JV642619.1
                                        [ECO:0000345]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1820              QNVO02000311.1     420734-422553       c
FEATURES             Location/Qualifiers
     source          1..1820
                     /organism="Macaca mulatta"
                     /mol_type="mRNA"
                     /db_xref="taxon:9544"
                     /chromosome="3"
                     /map="3"
     gene            1..1820
                     /gene="CLDN4"
                     /gene_synonym="claudin-4"
                     /note="claudin 4"
                     /db_xref="GeneID:716808"
                     /db_xref="VGNC:VGNC:80864"
     exon            1..1820
                     /gene="CLDN4"
                     /gene_synonym="claudin-4"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    335..337
                     /gene="CLDN4"
                     /gene_synonym="claudin-4"
                     /note="upstream in-frame stop codon"
     CDS             341..970
                     /gene="CLDN4"
                     /gene_synonym="claudin-4"
                     /codon_start=1
                     /product="claudin-4"
                     /protein_id="NP_001181493.1"
                     /db_xref="GeneID:716808"
                     /db_xref="VGNC:VGNC:80864"
                     /translation="
MASMGLQVTGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLLVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV"
     misc_feature    350..850
                     /gene="CLDN4"
                     /gene_synonym="claudin-4"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:328820"
ORIGIN      
aaaagtgcctttgttggcctgggctcaggaatccagagaaactggtcaggaggaggtcccggtgatgaaaacccctccctctgcccccgcccctctgccagagccatataactgctcaacctgtcctgagagagagagtgccctggcagctgtcggctggaaggaactggtctgctcacactcgctggcttgtgcatcaggactggctttttctcctgactcacagcgcaaaggagctctctgtgaacgttaagtccgtccccagcgcttggaatcctacggcctcctcagccggatcccctcagccttccaggtcctcaacctccgcggacgctgagcgatggcctccatggggctacaggtgacgggcatcgcgctggccgtcctgggctggctggccgtcatgctgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatcgtcacctcgcagaccatctgggagggcctgtggatgaactgcgtggtgcagagcaccggccagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcccgcgccctcgtcatcatcagcatcatcgtggccgctctgggcgtgctgctgtccgtggtggggggcaagtgtacaaactgcctggaggatgagagtgccaaggccaagaccatgatcgtggcgggtgtggtgttcctgttggccggcctgctggtgatagtgcccgtgtcctggacggcccacaacatcatccaagacttctacaacccgctggtggcctccgggcagaagcgggagatgggtgcctcgctctacgtcggctgggctgcctccggcctgctgctgcttggcggggggctgctttgctgcaactgcccaccccgcacagacaagccttactctgccaagtattctgccgcccgctctgctgctgccagcaactacgtgtaaggtgccacggctccactctgtccctctctgctttgttcttccctggactgagctcagcacaggctgtgaccccaggagggccctgccacgggcccctggctgctggggactggggactgggcagagactgagccaggcaggaaggcagcagccttcagcctctctggcccattcggacaccttcccaaggccgcctcctgctagcaagaacagagtccaccctcctctggatattgtggagggacggaagtgacagggtgtggcagtggagtggggagctggcttctgctggccaggatggctcaaccgtgactttgggctctgcctgcatcggtgttggccactgtccccatttacattttccccactctgtctgcctgcatctcctctgttccgggcaggccttgatgtcacctctaggactgtgccttgctcaccgaaacccgcacccaggagtatggctgaggccttgcccacccacctgcctgaggagggcagagtggatggacgggtttggaggggaggggtgaaggctttgtaaacaggtttgggcagtggtgggggagggggccagagaggccgctcaggctgcccagctctgtggcctcaggactctgcctcacccacttcagccctgggccactggagactgatccccctgagtcctctgcccctgccaaggacactaaccagcctgggagggtggcagggaggaggggcggcttcaccctcgggagtcctggggttcttcctcctccttcttcgtggtttctgttttgtaatttaagaagatctattcatcactgtaattattattattttctacaataaatggaacctgtgcacagga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]