GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-01-24 05:00:19, GGRNA.v2 : RefSeq release 203 (Nov, 2020)

LOCUS       NM_001194152            2154 bp    mRNA    linear   PRI 11-JUL-2020
DEFINITION  Macaca mulatta claudin 8 (CLDN8), mRNA.
ACCESSION   NM_001194152 XM_001100214
VERSION     NM_001194152.2
KEYWORDS    RefSeq.
SOURCE      Macaca mulatta (Rhesus monkey)
  ORGANISM  Macaca mulatta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
REFERENCE   1  (bases 1 to 2154)
  AUTHORS   Yan G, Zhang G, Fang X, Zhang Y, Li C, Ling F, Cooper DN, Li Q, Li
            Y, van Gool AJ, Du H, Chen J, Chen R, Zhang P, Huang Z, Thompson
            JR, Meng Y, Bai Y, Wang J, Zhuo M, Wang T, Huang Y, Wei L, Li J,
            Wang Z, Hu H, Yang P, Le L, Stenson PD, Li B, Liu X, Ball EV, An N,
            Huang Q, Zhang Y, Fan W, Zhang X, Li Y, Wang W, Katze MG, Su B,
            Nielsen R, Yang H, Wang J, Wang X and Wang J.
  TITLE     Genome sequencing and comparison of two nonhuman primate animal
            models, the cynomolgus and Chinese rhesus macaques
  JOURNAL   Nat. Biotechnol. 29 (11), 1019-1023 (2011)
   PUBMED   22002653
  REMARK    Publication Status: Online-Only
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from QNVO02000307.1.
            On Aug 1, 2019 this sequence version replaced NM_001194152.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-2154              QNVO02000307.1     16458004-16460157
FEATURES             Location/Qualifiers
     source          1..2154
                     /organism="Macaca mulatta"
                     /mol_type="mRNA"
                     /db_xref="taxon:9544"
                     /chromosome="3"
                     /map="3"
     gene            1..2154
                     /gene="CLDN8"
                     /gene_synonym="Claudin-8"
                     /note="claudin 8"
                     /db_xref="GeneID:705345"
                     /db_xref="VGNC:VGNC:81289"
     exon            1..2154
                     /gene="CLDN8"
                     /gene_synonym="Claudin-8"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    206..208
                     /gene="CLDN8"
                     /gene_synonym="Claudin-8"
                     /note="upstream in-frame stop codon"
     CDS             227..904
                     /gene="CLDN8"
                     /gene_synonym="Claudin-8"
                     /codon_start=1
                     /product="claudin-8"
                     /protein_id="NP_001181081.1"
                     /db_xref="GeneID:705345"
                     /db_xref="VGNC:VGNC:81289"
                     /translation="
MATHALEIAGLFLGGVGMVGTVAVTVMPQWRVSAFIENNIVVFENFWEGLWMNCVRQANIRMQCKIYDSLLALSPDLQAARGLMCAASVMSFLAFMMAILGMKCTRCTGDNEKVKAHILLTAGIIFIITGMVVLIPVSWVANAIIRDFYNPIVNVAQKRELGEALYLGWTTALVLIVGGALFCCIFCCNEKSSSYRYSIPSHRTTQRSYHMEKKSPSVYSRSQYV"
     misc_feature    239..772
                     /gene="CLDN8"
                     /gene_synonym="Claudin-8"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
ORIGIN      
gatttgtaagtttacctgttgcagccaataacagggccatctcagccagccagcactggatactatctggccagaagtagcaaagcagctcttatttgaaaagccactgggttctgagttcattactacagcaaaaactgttctcttctgtggcacagagaaccttgcttcaaagcagaactagcagctcgggagtccagctgactaaaacccatcccaggggataatggcaacccatgccttagaaattgctgggctgtttcttggtggtgttggaatggtgggcacagtggctgtcaccgtcatgcctcagtggagagtgtcggccttcattgaaaacaacatcgtggtgtttgaaaacttctgggaaggactgtggatgaattgcgtgaggcaggctaacatcaggatgcagtgcaaaatctatgattccctgttggctctttctccggacctacaggcagccagaggactgatgtgtgctgcttccgtaatgtccttcttggctttcatgatggccatccttggcatgaaatgcaccaggtgcacgggggacaatgagaaggtgaaggctcacattctgctgacagctggaatcatcttcatcatcacgggcatggtggtgctcatccctgtgagctgggttgccaatgccatcatcagagatttctataacccgatagtgaatgttgcccaaaaacgtgagcttggagaagccctctacttaggatggaccactgcactcgtgctcattgttggaggagccctgttctgttgtattttttgttgcaacgaaaagagcagtagctacagatactcgataccctcccatcgcacaacccaaagaagttatcacatggaaaagaagtcaccgagcgtctactccagatctcagtatgtgtagttgtgtatgtttttataactttactataaagccatgcaaatgattaaaatctctattattttctcaaaatggaccccaaagaaactttgatttactgttcttaactgcttaatcttaattacaggaactgtgcatcagctatttatgattctataagctatttcagcagaatgagatattaaacccaatgcttttattgttctaaagtacagtaatttgttttctaagatgattcaagcgcccactatttttatcatttacttcaaaatgacattgctaaagactgcattattttaccactgtaatttctccatgacatagcattatgtacatagatgagtgtaacatttatatcttacatagagacatgcttatatggttttatttgaaatgaaatgccgatccattacactgaataaatagaactcaactattgcttttcagggaaatcatggataggattgaagaaggtttctattaattgtttaaaaacagcttagggattaatgtcctccgtttataatgaaggttaaaatgaaggctttaatcagcattgtaaaggaaattgaatggctttctgatatgctgttttttagcctaggagttggaaatcctaacttctttatcctcttctcccagaggctttttttttcttgtatattaaattaacatttttaaaaagcagatattttgtcaagaggctttgcattcaaactgcttttccagggctacactcagaggaaagataaaagtgtgatctaagaaaaagtgatggttttagaaaagtgaaaatattttttcttattatgtttttatatttgaagaagaatgatgcattttgacaagaaatcatttatgtatgggtgtattttaataagtatttgagtacagactttgaggtttcatcaatataaataaaagagcagaaaaatatgtcttggttttcatttacttaccaaaaaaacaacaacaacaaaaaataaagttgtcctttgagaacttcacctgctcctatgcgggtacctaagtcaaaattgacatttttgttctgtgaaaaataaatttccttcttgtaccatttctgtttagttttactaaagtctgtaaatactgtatttttctgtttattccaaatttgatgaaactgacaatccagtttgaaagtttgtgtcaatgtctgtctagcttaaatgaatgtgttctatttgctttatacttttatattaataaattgtacttttttctaatta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]