GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-10 04:00:57, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001191873            1158 bp    mRNA    linear   ROD 31-MAR-2024
DEFINITION  Rattus norvegicus goosecoid homeobox (Gsc), mRNA.
ACCESSION   NM_001191873 XM_343101
VERSION     NM_001191873.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1158)
  AUTHORS   Parry,D.A., Logan,C.V., Stegmann,A.P., Abdelhamed,Z.A., Calder,A.,
            Khan,S., Bonthron,D.T., Clowes,V., Sheridan,E., Ghali,N.,
            Chudley,A.E., Dobbie,A., Stumpel,C.T. and Johnson,C.A.
  TITLE     SAMS, a syndrome of short stature, auditory-canal atresia,
            mandibular hypoplasia, and skeletal abnormalities is a unique
            neurocristopathy caused by mutations in Goosecoid
  JOURNAL   Am J Hum Genet 93 (6), 1135-1142 (2013)
   PUBMED   24290375
  REMARK    Review article
REFERENCE   2  (bases 1 to 1158)
  AUTHORS   Pereira,L.A., Wong,M.S., Lim,S.M., Sides,A., Stanley,E.G. and
            Elefanty,A.G.
  TITLE     Brachyury and related Tbx proteins interact with the Mixl1
            homeodomain protein and negatively regulate Mixl1 transcriptional
            activity
  JOURNAL   PLoS One 6 (12), e28394 (2011)
   PUBMED   22164283
REFERENCE   3  (bases 1 to 1158)
  AUTHORS   Lee,D., Park,C., Lee,H., Lugus,J.J., Kim,S.H., Arentson,E.,
            Chung,Y.S., Gomez,G., Kyba,M., Lin,S., Janknecht,R., Lim,D.S. and
            Choi,K.
  TITLE     ER71 acts downstream of BMP, Notch, and Wnt signaling in blood and
            vessel progenitor specification
  JOURNAL   Cell Stem Cell 2 (5), 497-507 (2008)
   PUBMED   18462699
REFERENCE   4  (bases 1 to 1158)
  AUTHORS   Izzi,L., Silvestri,C., von Both,I., Labbe,E., Zakin,L., Wrana,J.L.
            and Attisano,L.
  TITLE     Foxh1 recruits Gsc to negatively regulate Mixl1 expression during
            early mouse development
  JOURNAL   EMBO J 26 (13), 3132-3143 (2007)
   PUBMED   17568773
REFERENCE   5  (bases 1 to 1158)
  AUTHORS   Lewis,S.L., Khoo,P.L., Andrea De Young,R., Bildsoe,H., Wakamiya,M.,
            Behringer,R.R., Mukhopadhyay,M., Westphal,H. and Tam,P.P.
  TITLE     Genetic interaction of Gsc and Dkk1 in head morphogenesis of the
            mouse
  JOURNAL   Mech Dev 124 (2), 157-165 (2007)
   PUBMED   17127040
REFERENCE   6  (bases 1 to 1158)
  AUTHORS   Borges,A.C., Marques,S. and Belo,J.A.
  TITLE     Goosecoid and cerberus-like do not interact during mouse
            embryogenesis
  JOURNAL   Int J Dev Biol 46 (2), 259-262 (2002)
   PUBMED   11934155
REFERENCE   7  (bases 1 to 1158)
  AUTHORS   Danilov,V., Blum,M., Schweickert,A., Campione,M. and
            Steinbeisser,H.
  TITLE     Negative autoregulation of the organizer-specific homeobox gene
            goosecoid
  JOURNAL   J Biol Chem 273 (1), 627-635 (1998)
   PUBMED   9417125
REFERENCE   8  (bases 1 to 1158)
  AUTHORS   Filosa,S., Rivera-Perez,J.A., Gomez,A.P., Gansmuller,A., Sasaki,H.,
            Behringer,R.R. and Ang,S.L.
  TITLE     Goosecoid and HNF-3beta genetically interact to regulate neural
            tube patterning during mouse embryogenesis
  JOURNAL   Development 124 (14), 2843-2854 (1997)
   PUBMED   9226455
REFERENCE   9  (bases 1 to 1158)
  AUTHORS   Rivera-Perez,J.A., Mallo,M., Gendron-Maguire,M., Gridley,T. and
            Behringer,R.R.
  TITLE     Goosecoid is not an essential component of the mouse gastrula
            organizer but is required for craniofacial and rib development
  JOURNAL   Development 121 (9), 3005-3012 (1995)
   PUBMED   7555726
REFERENCE   10 (bases 1 to 1158)
  AUTHORS   Yamada,G., Mansouri,A., Torres,M., Stuart,E.T., Blum,M.,
            Schultz,M., De Robertis,E.M. and Gruss,P.
  TITLE     Targeted mutation of the murine goosecoid gene results in
            craniofacial defects and neonatal death
  JOURNAL   Development 121 (9), 2917-2922 (1995)
   PUBMED   7555718
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JAXUCZ010000006.1.
            
            On Jul 17, 2010 this sequence version replaced XM_343101.4.
            
            Summary: The protein encoded by this gene is likely a homeobox
            transcription factor. [provided by RefSeq, Jul 2008].
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR26643290.23953.1,
                                           SRR22582424.1233784.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN06621351, SAMN09345238
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-467               JAXUCZ010000006.1  129154409-129154875 c
            468-727             JAXUCZ010000006.1  129153628-129153887 c
            728-1158            JAXUCZ010000006.1  129152836-129153266 c
FEATURES             Location/Qualifiers
     source          1..1158
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="6"
                     /map="6q32"
     gene            1..1158
                     /gene="Gsc"
                     /note="goosecoid homeobox"
                     /db_xref="GeneID:317715"
                     /db_xref="RGD:631425"
     exon            1..467
                     /gene="Gsc"
                     /inference="alignment:Splign:2.1.0"
     CDS             113..883
                     /gene="Gsc"
                     /note="homeobox protein goosecoid-like"
                     /codon_start=1
                     /product="homeobox protein goosecoid"
                     /protein_id="NP_001178802.1"
                     /db_xref="GeneID:317715"
                     /db_xref="RGD:631425"
                     /translation="
MPASMFSIDNILAARPRCKDAVLPVAPSAAAPVVFPALHGDSLYGAGGGTSSDYGAFYPRPVAPGGAGLPAAVGGSRLGYNSYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSKASPEKREEEGKSDLDSDS"
     misc_feature    593..763
                     /gene="Gsc"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            468..727
                     /gene="Gsc"
                     /inference="alignment:Splign:2.1.0"
     exon            728..1158
                     /gene="Gsc"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
cgcgggagcacagagtgggacaacccccaacccccaccccaaacaacaccacttggagacttcttcttcggcgcgtccccgccgccccccggtcccggcgcggggctcggggatgcccgccagcatgttcagcatcgacaacatcctggccgcccggccgcgctgcaaagacgcggtgctcccggtggcgcccagcgccgcggctccggtggtctttccggctctgcacggggactcgctctacggcgctggcggcggcacctcctcggactacggcgccttctacccgcgtcctgtggcccctggaggcgcgggcctcccggccgcggtcggcggctcccgcctgggctacaacagctacttctacgggcagctgcacgtgcaggcggcgcccgtgggcccggcctgctgcggggctgtgccgccgctgggcgcccagcagtgttcctgcgtcccgacgcccccaggctacgagggccccggttctgtactggtgtctccagtgccgcaccagatgctgccctatatgaacgtgggcacgctgtcgcgcactgagctgcagctgctcaaccagctgcactgtcgacggaagcggcggcaccgcaccatcttcaccgacgagcagctcgaagccctggagaacctcttccaggagacaaagtacccagacgtgggcactcgggagcaactggcccggaaggtgcacctccgggaggagaaggtggaggtctggtttaagaaccgccgagccaaatggagacgacagaagagatcctcctcagaggagtcggaaaacgctgagaagtggaacaagacgtcctcgaaagcctcaccagagaagagggaagaggaaggtaaaagcgatttggactcggacagctgacggccgcgggccggccggggcgcttgcctgacgcaaggacttgcacagacagtcgatgctacttgcacacgccctgccttgcgggagggggtcgaagaagcaacgaggagctagctgtaaataatgtaaaggtccgggactgccagggacaggcgcgtggggaccgcagccccgcgtcccgggctgcctgcgtgagccgcgttccccaccgtagtatttatagttaagttaacggtgacagtacaataaagtgatggcgatgcagaccagccatg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]