2025-09-17 09:00:31, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001191873 1158 bp mRNA linear ROD 31-MAR-2024 DEFINITION Rattus norvegicus goosecoid homeobox (Gsc), mRNA. ACCESSION NM_001191873 XM_343101 VERSION NM_001191873.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1158) AUTHORS Parry,D.A., Logan,C.V., Stegmann,A.P., Abdelhamed,Z.A., Calder,A., Khan,S., Bonthron,D.T., Clowes,V., Sheridan,E., Ghali,N., Chudley,A.E., Dobbie,A., Stumpel,C.T. and Johnson,C.A. TITLE SAMS, a syndrome of short stature, auditory-canal atresia, mandibular hypoplasia, and skeletal abnormalities is a unique neurocristopathy caused by mutations in Goosecoid JOURNAL Am J Hum Genet 93 (6), 1135-1142 (2013) PUBMED 24290375 REMARK Review article REFERENCE 2 (bases 1 to 1158) AUTHORS Pereira,L.A., Wong,M.S., Lim,S.M., Sides,A., Stanley,E.G. and Elefanty,A.G. TITLE Brachyury and related Tbx proteins interact with the Mixl1 homeodomain protein and negatively regulate Mixl1 transcriptional activity JOURNAL PLoS One 6 (12), e28394 (2011) PUBMED 22164283 REFERENCE 3 (bases 1 to 1158) AUTHORS Lee,D., Park,C., Lee,H., Lugus,J.J., Kim,S.H., Arentson,E., Chung,Y.S., Gomez,G., Kyba,M., Lin,S., Janknecht,R., Lim,D.S. and Choi,K. TITLE ER71 acts downstream of BMP, Notch, and Wnt signaling in blood and vessel progenitor specification JOURNAL Cell Stem Cell 2 (5), 497-507 (2008) PUBMED 18462699 REFERENCE 4 (bases 1 to 1158) AUTHORS Izzi,L., Silvestri,C., von Both,I., Labbe,E., Zakin,L., Wrana,J.L. and Attisano,L. TITLE Foxh1 recruits Gsc to negatively regulate Mixl1 expression during early mouse development JOURNAL EMBO J 26 (13), 3132-3143 (2007) PUBMED 17568773 REFERENCE 5 (bases 1 to 1158) AUTHORS Lewis,S.L., Khoo,P.L., Andrea De Young,R., Bildsoe,H., Wakamiya,M., Behringer,R.R., Mukhopadhyay,M., Westphal,H. and Tam,P.P. TITLE Genetic interaction of Gsc and Dkk1 in head morphogenesis of the mouse JOURNAL Mech Dev 124 (2), 157-165 (2007) PUBMED 17127040 REFERENCE 6 (bases 1 to 1158) AUTHORS Borges,A.C., Marques,S. and Belo,J.A. TITLE Goosecoid and cerberus-like do not interact during mouse embryogenesis JOURNAL Int J Dev Biol 46 (2), 259-262 (2002) PUBMED 11934155 REFERENCE 7 (bases 1 to 1158) AUTHORS Danilov,V., Blum,M., Schweickert,A., Campione,M. and Steinbeisser,H. TITLE Negative autoregulation of the organizer-specific homeobox gene goosecoid JOURNAL J Biol Chem 273 (1), 627-635 (1998) PUBMED 9417125 REFERENCE 8 (bases 1 to 1158) AUTHORS Filosa,S., Rivera-Perez,J.A., Gomez,A.P., Gansmuller,A., Sasaki,H., Behringer,R.R. and Ang,S.L. TITLE Goosecoid and HNF-3beta genetically interact to regulate neural tube patterning during mouse embryogenesis JOURNAL Development 124 (14), 2843-2854 (1997) PUBMED 9226455 REFERENCE 9 (bases 1 to 1158) AUTHORS Rivera-Perez,J.A., Mallo,M., Gendron-Maguire,M., Gridley,T. and Behringer,R.R. TITLE Goosecoid is not an essential component of the mouse gastrula organizer but is required for craniofacial and rib development JOURNAL Development 121 (9), 3005-3012 (1995) PUBMED 7555726 REFERENCE 10 (bases 1 to 1158) AUTHORS Yamada,G., Mansouri,A., Torres,M., Stuart,E.T., Blum,M., Schultz,M., De Robertis,E.M. and Gruss,P. TITLE Targeted mutation of the murine goosecoid gene results in craniofacial defects and neonatal death JOURNAL Development 121 (9), 2917-2922 (1995) PUBMED 7555718 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JAXUCZ010000006.1. On Jul 17, 2010 this sequence version replaced XM_343101.4. Summary: The protein encoded by this gene is likely a homeobox transcription factor. [provided by RefSeq, Jul 2008]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR26643290.23953.1, SRR22582424.1233784.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN06621351, SAMN09345238 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-467 JAXUCZ010000006.1 129154409-129154875 c 468-727 JAXUCZ010000006.1 129153628-129153887 c 728-1158 JAXUCZ010000006.1 129152836-129153266 c FEATURES Location/Qualifiers source 1..1158 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="6" /map="6q32" gene 1..1158 /gene="Gsc" /note="goosecoid homeobox" /db_xref="GeneID:317715" /db_xref="RGD:631425" exon 1..467 /gene="Gsc" /inference="alignment:Splign:2.1.0" CDS 113..883 /gene="Gsc" /note="homeobox protein goosecoid-like" /codon_start=1 /product="homeobox protein goosecoid" /protein_id="NP_001178802.1" /db_xref="GeneID:317715" /db_xref="RGD:631425" /translation="
MPASMFSIDNILAARPRCKDAVLPVAPSAAAPVVFPALHGDSLYGAGGGTSSDYGAFYPRPVAPGGAGLPAAVGGSRLGYNSYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSKASPEKREEEGKSDLDSDS"
misc_feature 593..763 /gene="Gsc" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 468..727 /gene="Gsc" /inference="alignment:Splign:2.1.0" exon 728..1158 /gene="Gsc" /inference="alignment:Splign:2.1.0" ORIGIN
cgcgggagcacagagtgggacaacccccaacccccaccccaaacaacaccacttggagacttcttcttcggcgcgtccccgccgccccccggtcccggcgcggggctcggggatgcccgccagcatgttcagcatcgacaacatcctggccgcccggccgcgctgcaaagacgcggtgctcccggtggcgcccagcgccgcggctccggtggtctttccggctctgcacggggactcgctctacggcgctggcggcggcacctcctcggactacggcgccttctacccgcgtcctgtggcccctggaggcgcgggcctcccggccgcggtcggcggctcccgcctgggctacaacagctacttctacgggcagctgcacgtgcaggcggcgcccgtgggcccggcctgctgcggggctgtgccgccgctgggcgcccagcagtgttcctgcgtcccgacgcccccaggctacgagggccccggttctgtactggtgtctccagtgccgcaccagatgctgccctatatgaacgtgggcacgctgtcgcgcactgagctgcagctgctcaaccagctgcactgtcgacggaagcggcggcaccgcaccatcttcaccgacgagcagctcgaagccctggagaacctcttccaggagacaaagtacccagacgtgggcactcgggagcaactggcccggaaggtgcacctccgggaggagaaggtggaggtctggtttaagaaccgccgagccaaatggagacgacagaagagatcctcctcagaggagtcggaaaacgctgagaagtggaacaagacgtcctcgaaagcctcaccagagaagagggaagaggaaggtaaaagcgatttggactcggacagctgacggccgcgggccggccggggcgcttgcctgacgcaaggacttgcacagacagtcgatgctacttgcacacgccctgccttgcgggagggggtcgaagaagcaacgaggagctagctgtaaataatgtaaaggtccgggactgccagggacaggcgcgtggggaccgcagccccgcgtcccgggctgcctgcgtgagccgcgttccccaccgtagtatttatagttaagttaacggtgacagtacaataaagtgatggcgatgcagaccagccatg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]