GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-11-02 21:16:34, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001191087             876 bp    mRNA    linear   ROD 03-APR-2024
DEFINITION  Rattus norvegicus homeobox A6 (Hoxa6), mRNA.
ACCESSION   NM_001191087 XM_001065038
VERSION     NM_001191087.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 876)
  AUTHORS   Deng,J., Ding,H.H., Long,J.L., Lin,S.Y., Liu,M., Zhang,X.Q.,
            Xin,W.J. and Ruan,X.
  TITLE     Oxaliplatin-induced neuropathic pain involves HOXA6 via a
            TET1-dependent demethylation of the SOX10 promoter
  JOURNAL   Int J Cancer 147 (9), 2503-2514 (2020)
   PUBMED   32428246
  REMARK    GeneRIF: Oxaliplatin-induced neuropathic pain involves HOXA6 via a
            TET1-dependent demethylation of the SOX10 promoter.
            Erratum:[Int J Cancer. 2021 Sep 15;149(6):E10. PMID: 34196406]
REFERENCE   2  (bases 1 to 876)
  AUTHORS   McIntyre,D.C., Rakshit,S., Yallowitz,A.R., Loken,L., Jeannotte,L.,
            Capecchi,M.R. and Wellik,D.M.
  TITLE     Hox patterning of the vertebrate rib cage
  JOURNAL   Development 134 (16), 2981-2989 (2007)
   PUBMED   17626057
REFERENCE   3  (bases 1 to 876)
  AUTHORS   Polyak,K., Lee,M.H., Erdjument-Bromage,H., Koff,A., Roberts,J.M.,
            Tempst,P. and Massague,J.
  TITLE     Cloning of p27Kip1, a cyclin-dependent kinase inhibitor and a
            potential mediator of extracellular antimitogenic signals
  JOURNAL   Cell 78 (1), 59-66 (1994)
   PUBMED   8033212
REFERENCE   4  (bases 1 to 876)
  AUTHORS   Kostic,D. and Capecchi,M.R.
  TITLE     Targeted disruptions of the murine Hoxa-4 and Hoxa-6 genes result
            in homeotic transformations of components of the vertebral column
  JOURNAL   Mech Dev 46 (3), 231-247 (1994)
   PUBMED   7918106
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            JAXUCZ010000004.1.
            
            On Jul 17, 2010 this sequence version replaced XM_001065038.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR21887623.187091.1,
                                           SRR21887623.187094.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760386, SAMEA5760475
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-540               JAXUCZ010000004.1  82638924-82639463   c
            541-876             JAXUCZ010000004.1  82637024-82637359   c
FEATURES             Location/Qualifiers
     source          1..876
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q24"
     gene            1..876
                     /gene="Hoxa6"
                     /note="homeobox A6"
                     /db_xref="GeneID:685732"
                     /db_xref="RGD:1590236"
     exon            1..540
                     /gene="Hoxa6"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    30..32
                     /gene="Hoxa6"
                     /note="upstream in-frame stop codon"
     CDS             99..800
                     /gene="Hoxa6"
                     /note="homeobox protein Hox-A6-like"
                     /codon_start=1
                     /product="homeobox protein Hox-A6"
                     /protein_id="NP_001178016.1"
                     /db_xref="GeneID:685732"
                     /db_xref="RGD:1590236"
                     /translation="
MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGNSKQRGPGDYLHFSPEQQYKPDSSSVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGAVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQASGEDSEAKAGE"
     misc_feature    564..734
                     /gene="Hoxa6"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            541..876
                     /gene="Hoxa6"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ttcggccatccagaaacaaaccagttcgatgactactaatagttatagccagatgtactaatacacaacaaatcacagtcctgcagaggggcgcgcaaatgagttcctattttgtgaatcccactttccctgggagcctgcccagcggccaggactccttcttgggccagctgcccctctacccggccggctatgacgcgctgaggcccttcccggcctcttatggggcgtcgagtcttccggacaagacatacacctcaccttgtttctaccaacagtccaactcggtcctggcctgcaaccgggcatcctacgagtacggggcctcatgtttctattctgataaggacctcagtggcgcctcaccctcgggcaatagcaagcagaggggccccggggactacctgcacttttctcccgagcagcagtacaaacctgacagcagcagcgtgcagggcaaagccctccatgaggaaggcaccgaccggaagtacacaagccctgtttacccctggatgcagcggatgaattcctgtgcgggtgctgtgtatgggagtcacgggcgcagaggccgccagacctacacgcgctaccagaccctggagctggagaaggaattccacttcaaccgctacctgactcggcggcgccgcatcgagatcgccaacgcgctctgcctcaccgagcgccagatcaagatctggttccagaatcggcgcatgaagtggaaaaaggaaaataaactcatcaattccacgcaggccagcggggaagactctgaggccaaggcgggcgagtagactccaggcagggaccaggccatcgttgtaacctctattggctttgccccctggtgcccttgcctgctccccaagt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]