GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2018-06-23 22:44:12, GGRNA.v2 : RefSeq release 88 (May, 2018)

LOCUS       NM_001185023            1944 bp    mRNA    linear   PRI 09-MAY-2018
DEFINITION  Homo sapiens claudin 7 (CLDN7), transcript variant 3, mRNA.
ACCESSION   NM_001185023
VERSION     NM_001185023.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1944)
  AUTHORS   Liu H, Jiang F, Jia X, Lan J, Guo H, Li E, Yan A and Wang Y.
  TITLE     Cycling hypoxia affects cell invasion and proliferation through
            direct regulation of claudin1 / claudin7 expression, and indirect
            regulation of P18 through claudin7
  JOURNAL   Oncotarget 8 (6), 10298-10311 (2017)
   PUBMED   28055967
  REMARK    GeneRIF: Cycling hypoxia could induce significant changes in CLDN1
            and CLDN7 expression in nasopharyngeal cancer cells, indirectly
            regulation P18 expression and affecting cell
            invasion/proliferation.
REFERENCE   2  (bases 1 to 1944)
  AUTHORS   Wu,C.J., Feng,X., Lu,M., Morimura,S. and Udey,M.C.
  TITLE     Matriptase-mediated cleavage of EpCAM destabilizes claudins and
            dysregulates intestinal epithelial homeostasis
  JOURNAL   J. Clin. Invest. 127 (2), 623-634 (2017)
   PUBMED   28094766
  REMARK    GeneRIF: These results identify EpCAM as a substrate of matriptase
            and link HAI-2, matriptase, EpCAM, and claudin-7 in a functionally
            important pathway that causes disease when it is dysregulated.
REFERENCE   3  (bases 1 to 1944)
  AUTHORS   Akizuki R, Shimobaba S, Matsunaga T, Endo S and Ikari A.
  TITLE     Claudin-5, -7, and -18 suppress proliferation mediated by
            inhibition of phosphorylation of Akt in human lung squamous cell
            carcinoma
  JOURNAL   Biochim. Biophys. Acta 1864 (2), 293-302 (2017)
   PUBMED   27884700
  REMARK    GeneRIF: suggest that the reduction of CLDN5, 7, and 18 expression
            loses the suppressive ability of interaction between PDK1 and Akt
            and causes sustained phosphorylation of Akt, resulting in the
            disordered proliferation in lung squamous carcinoma cells
REFERENCE   4  (bases 1 to 1944)
  AUTHORS   Oleinikova NA, Kharlova OA, Mal'kov PG and Danilova NV.
  TITLE     [The expression of claudins in colonic neoplasms]
  JOURNAL   Arkh. Patol. 79 (1), 28-35 (2017)
   PUBMED   28295005
  REMARK    GeneRIF: 84/118, 64/118, 52/118 reaction with claudin-1, claudin-3
            and claudin-4 in cancer and colon polyps had a membrane
            localization, respectively.Mislocalization claudin-3 to nucleus in
            colon cancer and mislocalization claudin-4 to nucleus in adenomas
            of the colon were detected for the first time.
REFERENCE   5  (bases 1 to 1944)
  AUTHORS   Ono Y, Hiratsuka Y, Murata M, Takasawa A, Fukuda R, Nojima M,
            Tanaka S, Osanai M, Hirata K and Sawada N.
  TITLE     Claudins-4 and -7 might be valuable markers to distinguish
            hepatocellular carcinoma from cholangiocarcinoma
  JOURNAL   Virchows Arch. 469 (4), 417-426 (2016)
   PUBMED   27444172
  REMARK    GeneRIF: that claudins-4 and -7 might be valuable markers for
            distinguishing hepatocellular carcinoma and cholangiocarcinoma and
            that cholangiolocellular carcinoma might arise from hepatic ductal
            cells
REFERENCE   6  (bases 1 to 1944)
  AUTHORS   Heiskala M, Peterson PA and Yang Y.
  TITLE     The roles of claudin superfamily proteins in paracellular transport
  JOURNAL   Traffic 2 (2), 93-98 (2001)
   PUBMED   11247307
  REMARK    Review article
REFERENCE   7  (bases 1 to 1944)
  AUTHORS   Kniesel U and Wolburg H.
  TITLE     Tight junctions of the blood-brain barrier
  JOURNAL   Cell. Mol. Neurobiol. 20 (1), 57-76 (2000)
   PUBMED   10690502
  REMARK    Review article
REFERENCE   8  (bases 1 to 1944)
  AUTHORS   Itoh M, Furuse M, Morita K, Kubota K, Saitou M and Tsukita S.
  TITLE     Direct binding of three tight junction-associated MAGUKs, ZO-1,
            ZO-2, and ZO-3, with the COOH termini of claudins
  JOURNAL   J. Cell Biol. 147 (6), 1351-1363 (1999)
   PUBMED   10601346
REFERENCE   9  (bases 1 to 1944)
  AUTHORS   Morita K, Furuse M, Fujimoto K and Tsukita S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 96 (2), 511-516 (1999)
   PUBMED   9892664
REFERENCE   10 (bases 1 to 1944)
  AUTHORS   Peacock RE, Keen TJ and Inglehearn CF.
  TITLE     Analysis of a human gene homologous to rat ventral prostate.1
            protein
  JOURNAL   Genomics 46 (3), 443-449 (1997)
   PUBMED   9441748
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CV575841.1, AC003688.1 and
            BC071844.1.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. Differential expression of this gene has been
            observed in different types of malignancies, including breast
            cancer, ovarian cancer, hepatocellular carcinomas, urinary tumors,
            prostate cancer, lung cancer, head and neck cancers, thyroid
            carcinomas, etc.. Alternatively spliced transcript variants
            encoding different isoforms have been found.[provided by RefSeq,
            May 2010].
            
            Transcript Variant: This variant (3) lacks an exon in the 3' CDS,
            as compared to variant 1. The resulting isoform (2) has a shorter
            and distinct C-terminus, as compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-468               CV575841.1         1-468
            469-1125            AC003688.1         64217-64873         c
            1126-1290           AC003688.1         63217-63381         c
            1291-1917           AC003688.1         62306-62932         c
            1918-1944           BC071844.1         1341-1367
FEATURES             Location/Qualifiers
     source          1..1944
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17p13.1"
     gene            1..1944
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="claudin 7"
                     /db_xref="GeneID:1366"
                     /db_xref="HGNC:HGNC:2049"
                     /db_xref="MIM:609131"
     exon            1..1125
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="alignment:Splign:2.1.0"
     variation       complement(1..2)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="gg"
                     /db_xref="dbSNP:1487791537"
     variation       complement(2..3)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1187413912"
     variation       complement(3)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192262608"
     variation       complement(4)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:969684358"
     variation       complement(10..11)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:137931761"
     variation       complement(21)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1388915149"
     variation       complement(26)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1456320794"
     variation       complement(29)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775894437"
     variation       complement(30)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1381019285"
     variation       complement(38)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780571096"
     variation       complement(41)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:998657472"
     variation       complement(42)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:901933810"
     variation       complement(46)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371045446"
     variation       complement(63)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758838454"
     variation       complement(67)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1320456242"
     variation       complement(69)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1328766972"
     variation       complement(72)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:962183181"
     variation       complement(73)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:556193383"
     variation       complement(76)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1483766998"
     variation       complement(80)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1200440582"
     variation       complement(86)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1015007659"
     variation       complement(88)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:910536331"
     variation       complement(90)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:796914082"
     variation       complement(97)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1183721960"
     variation       complement(99)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1411985760"
     variation       complement(100)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:142756120"
     variation       complement(103)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1156464787"
     variation       complement(104)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:545899911"
     variation       complement(105)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1029014350"
     variation       complement(107)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1302261442"
     variation       complement(112)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753298999"
     variation       complement(116)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576961998"
     variation       complement(124)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1359624888"
     variation       complement(133)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1226840914"
     variation       complement(140)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:972644994"
     variation       complement(143)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763645527"
     variation       complement(145)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142458277"
     variation       complement(146)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1313217087"
     variation       complement(150)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1232985401"
     variation       complement(154)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:554337874"
     variation       complement(164)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040304908"
     variation       complement(167)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1206438501"
     variation       complement(185)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1251957377"
     variation       complement(187..188)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:928402219"
     variation       complement(188)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755788418"
     variation       complement(191)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1426823473"
     variation       complement(193)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1433340210"
     variation       complement(194)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186079993"
     variation       complement(197)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1054254127"
     variation       complement(204)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:568720596"
     variation       complement(205)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1308532071"
     variation       complement(220)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1370086514"
     variation       complement(222)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:969720823"
     variation       complement(223)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759423564"
     variation       complement(225)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1183046681"
     variation       complement(230)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1483306941"
     variation       complement(235)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1368580080"
     variation       complement(239)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554977817"
     variation       complement(242)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1208662136"
     variation       complement(244)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:535411637"
     variation       complement(247)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044091417"
     variation       complement(248)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569680400"
     variation       complement(251)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1274532393"
     variation       complement(259)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1340927814"
     variation       complement(263)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147711018"
     variation       complement(264)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:918207999"
     variation       complement(268)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1218455534"
     variation       complement(269)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:867922127"
     variation       complement(270)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:533058576"
     variation       complement(273)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1315137211"
     variation       complement(276)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:570481954"
     variation       complement(286)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040504448"
     variation       complement(288)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1007634979"
     variation       complement(293)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1408080023"
     variation       complement(296)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889156164"
     variation       complement(297)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350494229"
     variation       complement(301)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1378538015"
     variation       complement(311)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457623708"
     variation       complement(315)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1301229491"
     variation       complement(317)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:908065045"
     variation       complement(318)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:985342039"
     variation       complement(327)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1297237060"
     variation       complement(338)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1331759974"
     variation       complement(339)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1464926262"
     variation       complement(340)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:180794153"
     variation       complement(344)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930621185"
     variation       complement(349)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1220439218"
     variation       complement(352)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1423826206"
     variation       complement(356)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1466143248"
     variation       complement(360)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:919511662"
     variation       complement(366)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1036588289"
     variation       complement(369)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1029477039"
     variation       complement(371)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1412433554"
     variation       complement(374)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:996223735"
     variation       complement(382)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1442058359"
     variation       complement(390)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1404825325"
     variation       complement(391)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:957637414"
     variation       complement(392)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1391113233"
     variation       complement(396)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1457912216"
     variation       complement(401)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:547557100"
     variation       complement(405)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:527512453"
     variation       complement(408)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1343758446"
     variation       complement(410..431)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="gggcgcgcgggccgcgcccccg"
                     /db_xref="dbSNP:890779433"
     variation       complement(411)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948467739"
     variation       complement(414)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:190323961"
     variation       complement(416)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379341242"
     variation       complement(420)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1010167676"
     variation       complement(426)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1267386586"
     variation       complement(428)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:891689951"
     variation       complement(433)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032023832"
     variation       complement(434)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:556724330"
     variation       complement(435)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:977316558"
     variation       complement(441)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1237978828"
     variation       complement(442)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:965896109"
     variation       complement(445..446)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1242463952"
     variation       complement(456)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:541762847"
     variation       complement(466)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1158663233"
     variation       complement(472)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1309920638"
     variation       complement(475)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:762972726"
     variation       complement(481)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1000420016"
     variation       complement(488)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1335534256"
     variation       complement(489)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1359104349"
     variation       complement(494)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:905641068"
     variation       complement(504)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310568522"
     variation       complement(511)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1394081659"
     variation       complement(512)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1295133566"
     variation       complement(517)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889202651"
     variation       complement(524)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044531057"
     variation       complement(531)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027706191"
     variation       complement(536)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1278997029"
     variation       complement(538)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1441792056"
     variation       complement(540)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1208586581"
     variation       complement(541)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:949790613"
     variation       complement(542)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458095622"
     variation       complement(549)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254118451"
     variation       complement(552)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773234630"
     variation       complement(557)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376553754"
     variation       complement(565)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995260452"
     variation       complement(566)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1181800749"
     variation       complement(567)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1362276395"
     variation       complement(581)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1479093250"
     variation       complement(583)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916921495"
     variation       complement(590)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:865833864"
     variation       complement(597)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036626442"
     variation       complement(598)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1433435698"
     variation       complement(606)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:940964473"
     variation       complement(610)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:908114304"
     variation       complement(619)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1371923766"
     variation       complement(621)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:897803569"
     variation       complement(628)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333633689"
     variation       complement(629)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438106745"
     variation       complement(637)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275249313"
     variation       complement(643)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036597111"
     variation       complement(645)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1232050496"
     variation       complement(650)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1421012498"
     variation       complement(652)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:562531705"
     variation       complement(657)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1204534727"
     variation       complement(658)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:545836584"
     variation       complement(661)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:906746495"
     variation       complement(664)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199803833"
     variation       complement(683)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1045209455"
     variation       complement(684)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1191119142"
     variation       complement(689)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:985003077"
     variation       complement(694)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1269908688"
     variation       complement(696)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145562713"
     variation       complement(699)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1429607739"
     variation       complement(703)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488265614"
     variation       complement(704)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1166830837"
     variation       complement(707)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393643322"
     variation       complement(720)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:915656521"
     variation       complement(730)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1263922341"
     variation       complement(733)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1370049768"
     variation       complement(740)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438432933"
     variation       complement(748)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:554859335"
     variation       complement(762)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:935687985"
     variation       complement(769)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:922082071"
     variation       complement(773)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1354505613"
     variation       complement(778)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1249727512"
     variation       complement(779)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1358522429"
     variation       complement(786..787)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="tt"
                     /db_xref="dbSNP:1286573700"
     variation       complement(796)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:924286331"
     variation       complement(803..805)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="tcc"
                     /db_xref="dbSNP:977368556"
     variation       complement(803)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333980478"
     variation       complement(808)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:975237626"
     variation       complement(813)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764443909"
     variation       complement(814)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376253030"
     variation       complement(818..820)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ctt"
                     /db_xref="dbSNP:1248981146"
     variation       complement(818)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467469613"
     variation       complement(819)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356023821"
     variation       complement(824)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1449425277"
     variation       complement(825)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1168830543"
     variation       complement(827)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:966086571"
     variation       complement(829)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775710738"
     variation       complement(832)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1430082081"
     variation       complement(836)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759574089"
     variation       complement(839)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185564333"
     variation       complement(840)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:770858925"
     variation       complement(842)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200696657"
     variation       complement(845)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1481834990"
     variation       complement(848)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459497098"
     variation       complement(854)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1322329322"
     variation       complement(855)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748120999"
     variation       complement(856)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1196370484"
     variation       complement(857)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1316917980"
     misc_feature    858..860
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="upstream in-frame stop codon"
     variation       complement(860)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1381619953"
     variation       complement(861)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1263285416"
     variation       complement(862)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781238084"
     variation       complement(864)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768594838"
     variation       complement(866)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:796437250"
     variation       complement(866)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300547900"
     variation       complement(868)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1293325573"
     variation       complement(869)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:56219105"
     variation       complement(869)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141537294"
     variation       complement(871)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199606116"
     variation       complement(873)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1433492809"
     variation       complement(874)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1375278270"
     variation       complement(876)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328969237"
     variation       complement(877)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746781493"
     variation       complement(878)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779894575"
     variation       complement(879)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033330581"
     variation       complement(883)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464633929"
     variation       complement(886)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1377089790"
     variation       complement(891)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758069878"
     variation       complement(893)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778866641"
     variation       complement(896)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421328771"
     variation       complement(897)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347539363"
     variation       complement(899)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1236803997"
     variation       complement(900)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749963386"
     CDS             903..1340
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="isoform 2 precursor is encoded by transcript
                     variant 3; clostridium perfringens enterotoxin
                     receptor-like 2"
                     /codon_start=1
                     /product="claudin-7 isoform 2 precursor"
                     /protein_id="NP_001171952.1"
                     /db_xref="CCDS:CCDS54081.1"
                     /db_xref="GeneID:1366"
                     /db_xref="HGNC:HGNC:2049"
                     /db_xref="MIM:609131"
                     /translation="
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGMSLALPSLLAGQGLP"
     sig_peptide     903..974
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    912..>1298
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
     misc_feature    924..986
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95471.4);
                     transmembrane region"
     misc_feature    1146..1208
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (O95471.4);
                     transmembrane region"
     variation       complement(908)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778496052"
     variation       complement(910)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374655416"
     variation       complement(913)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1201779323"
     variation       complement(914)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764533562"
     variation       complement(917)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761074982"
     variation       complement(918)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1239689928"
     variation       complement(919)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203949961"
     variation       complement(920)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355767769"
     variation       complement(924)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1258863306"
     variation       complement(927)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753027850"
     variation       complement(928)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1445726887"
     variation       complement(929)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383199505"
     variation       complement(940)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1014871951"
     variation       complement(944)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767698459"
     variation       complement(948)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759789750"
     variation       complement(950)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1003791768"
     variation       complement(960)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160891664"
     variation       complement(961)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:771964031"
     variation       963
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35178249"
     variation       complement(968)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1412501955"
     variation       complement(969)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1455867340"
     variation       complement(971)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774371364"
     variation       complement(977)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:771074161"
     variation       complement(979)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11655844"
     variation       complement(981)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1287114940"
     variation       complement(983)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1411814278"
     variation       complement(985)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763080763"
     variation       complement(986)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1013971519"
     variation       complement(992)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374957746"
     variation       complement(995)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768686747"
     variation       complement(997)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1254939116"
     variation       complement(1003)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1205196104"
     variation       complement(1009)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:574955449"
     variation       complement(1010)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283830501"
     variation       complement(1016)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1239291208"
     variation       complement(1018..1020)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="aca"
                     /db_xref="dbSNP:778664885"
     variation       complement(1018)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:771710986"
     variation       complement(1019)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:745726375"
     variation       complement(1021)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745535338"
     variation       complement(1028)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756811754"
     variation       complement(1035)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340093161"
     variation       complement(1036)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1045259550"
     variation       complement(1037)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:948237100"
     variation       complement(1042)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1383974416"
     variation       complement(1046)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:893954266"
     variation       complement(1047)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748773256"
     variation       complement(1049)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1346355674"
     variation       complement(1065)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298150934"
     variation       complement(1066)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199539972"
     variation       complement(1070)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144545597"
     variation       complement(1072)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753117808"
     variation       complement(1073)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200335308"
     variation       complement(1078)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1367511929"
     variation       complement(1082)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569618349"
     variation       complement(1084)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:556173986"
     variation       complement(1085)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1186828683"
     variation       complement(1086)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766489545"
     variation       complement(1088)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374173666"
     variation       complement(1090)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376371298"
     variation       complement(1091)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466522162"
     variation       complement(1108)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773424587"
     variation       complement(1113)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373360250"
     variation       complement(1119)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760706346"
     variation       complement(1121)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775220631"
     variation       complement(1122)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:944320634"
     variation       complement(1124)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:771152939"
     exon            1126..1290
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="alignment:Splign:2.1.0"
     variation       complement(1127)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1276524007"
     variation       complement(1130)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1019664423"
     variation       complement(1137)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1328383401"
     variation       complement(1141)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1352028474"
     variation       complement(1143)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:781744000"
     variation       complement(1144)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769041772"
     variation       complement(1150)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1376564183"
     variation       complement(1153)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:986873517"
     variation       complement(1154)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448217463"
     variation       complement(1158)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:954296922"
     variation       complement(1159)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1289972707"
     variation       complement(1163)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:560743926"
     variation       complement(1164)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149308129"
     variation       complement(1166)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:568192125"
     variation       complement(1167)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758773722"
     variation       complement(1168..1182)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="tgctgggcttcctgg"
                     /db_xref="dbSNP:929702652"
     variation       complement(1170)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750701862"
     variation       complement(1173)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1379386241"
     variation       complement(1174)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1184458638"
     variation       complement(1175)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1484353254"
     variation       complement(1178)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779224586"
     variation       complement(1181)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209469876"
     variation       complement(1182)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:547957587"
     variation       complement(1185)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757459277"
     variation       complement(1186)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:908450344"
     variation       complement(1191)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1305394346"
     variation       complement(1197)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758959441"
     variation       complement(1199)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144832882"
     variation       complement(1201)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373478236"
     variation       complement(1202)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762687113"
     variation       complement(1207)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772901497"
     variation       complement(1213)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1261083159"
     variation       complement(1216)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1476988508"
     variation       complement(1217)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769406740"
     variation       complement(1219)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761455420"
     variation       complement(1221)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1446617432"
     variation       complement(1224)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142682069"
     variation       complement(1225)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:867054456"
     variation       complement(1227)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1417726116"
     variation       complement(1228)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369146758"
     variation       complement(1229)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747479920"
     variation       complement(1230)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1425823001"
     variation       complement(1231)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1430383436"
     variation       complement(1233)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:568777982"
     variation       complement(1238)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746209260"
     variation       complement(1245)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1478207610"
     variation       complement(1246)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1265340892"
     variation       complement(1248)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1215103064"
     variation       complement(1249)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779314588"
     variation       complement(1252)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757414858"
     variation       complement(1254)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754006543"
     variation       complement(1255)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1323190163"
     variation       complement(1257)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777728095"
     variation       complement(1258)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227322853"
     variation       complement(1263)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1335000948"
     variation       complement(1265)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756152576"
     variation       complement(1266)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1279530576"
     variation       complement(1270..1271)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="gc"
                     /db_xref="dbSNP:1227140446"
     variation       complement(1284)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1398149433"
     variation       complement(1287)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:963756863"
     variation       complement(1289)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1339721273"
     exon            1291..1924
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /inference="alignment:Splign:2.1.0"
     variation       complement(1304)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478792995"
     variation       complement(1307)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1260973990"
     variation       complement(1309)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1192333333"
     variation       complement(1312)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368294497"
     variation       complement(1313)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328350299"
     variation       complement(1316)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1291690177"
     variation       complement(1317)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1340359693"
     variation       complement(1320)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1208347535"
     variation       complement(1323)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202218344"
     variation       complement(1325)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780943523"
     STS             1326..1465
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /standard_name="G54057"
                     /db_xref="UniSTS:109439"
     variation       complement(1326)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200203162"
     variation       complement(1327)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347087732"
     variation       complement(1330)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751075535"
     variation       complement(1331)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766852114"
     variation       complement(1333)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251355219"
     variation       complement(1336)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375656608"
     variation       complement(1338)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763527222"
     variation       complement(1339)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765618532"
     variation       complement(1340)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9912315"
     variation       complement(1341)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768840213"
     variation       complement(1344)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760815138"
     variation       complement(1348..1350)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ggg"
                     /db_xref="dbSNP:1208885081"
     variation       complement(1352)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775629594"
     variation       complement(1354)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1321956225"
     variation       complement(1354)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749255717"
     variation       complement(1358)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337392258"
     variation       complement(1360)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766274868"
     variation       complement(1365)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1420752858"
     variation       complement(1367..1368)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:751988367"
     variation       complement(1368)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777533955"
     variation       complement(1369)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769734637"
     variation       complement(1377)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478309213"
     variation       complement(1379)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374945200"
     variation       complement(1383)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:747934368"
     variation       complement(1384)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781058023"
     variation       complement(1385)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371721675"
     variation       complement(1387)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751114635"
     variation       complement(1389)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779618547"
     variation       complement(1390)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757803996"
     variation       complement(1391)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1272301681"
     variation       complement(1393)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1220368001"
     variation       complement(1395)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750960349"
     variation       complement(1397)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765708269"
     variation       complement(1402)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762201526"
     variation       complement(1403)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149875713"
     variation       complement(1404)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141055939"
     variation       complement(1405..1413)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="tgtaccccg"
                     /db_xref="dbSNP:766786518"
     variation       complement(1405)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750356848"
     variation       complement(1407)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4562"
     variation       complement(1410)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1327600201"
     variation       complement(1412)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200370674"
     variation       complement(1413)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773251272"
     variation       complement(1417)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1453607281"
     variation       complement(1418)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769849262"
     variation       complement(1419)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1180753853"
     variation       complement(1420)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761984728"
     variation       complement(1421)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748013881"
     variation       complement(1422)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200825966"
     variation       complement(1423)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3744400"
     variation       complement(1428)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200179958"
     variation       complement(1430)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1035730816"
     variation       complement(1432)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1277163550"
     variation       complement(1433)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139088043"
     variation       complement(1435)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373668129"
     variation       complement(1438)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:745334807"
     variation       complement(1444)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150733809"
     variation       complement(1446)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369723431"
     variation       complement(1448)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754288281"
     variation       complement(1450)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764449775"
     variation       complement(1453)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756396409"
     variation       complement(1470)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:767612596"
     variation       complement(1471)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759702143"
     variation       complement(1473)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376741365"
     variation       complement(1474)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1160228957"
     variation       complement(1476)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:931259883"
     variation       complement(1480)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139056264"
     variation       complement(1482)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761845015"
     variation       complement(1483)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1039568345"
     variation       complement(1484)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1473822214"
     variation       complement(1485)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:942502314"
     variation       complement(1487)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776668453"
     variation       complement(1491)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:768516015"
     variation       complement(1495)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1288656088"
     variation       complement(1496..1497)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34184791"
     variation       complement(1496)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1214873941"
     variation       complement(1499)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775244828"
     variation       complement(1501)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1470084160"
     variation       complement(1505)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419179338"
     variation       complement(1510)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:912352748"
     variation       complement(1511)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1001008709"
     variation       complement(1524)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:554259644"
     variation       complement(1525)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1021108252"
     variation       complement(1526)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:537621453"
     variation       complement(1529)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576047180"
     variation       complement(1531)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1241889835"
     variation       complement(1532)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:935031475"
     variation       complement(1535)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1280651152"
     variation       complement(1546)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746605493"
     variation       complement(1547)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:557381253"
     variation       complement(1548)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461141895"
     variation       complement(1550)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:979486034"
     variation       complement(1559)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:969023075"
     variation       complement(1569..1570)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:1200654189"
     variation       complement(1571)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1166223809"
     variation       complement(1572)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1405473579"
     variation       complement(1574)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1183636853"
     variation       complement(1575..1576)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:899819649"
     variation       complement(1579)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:539027720"
     variation       complement(1580)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1157045535"
     variation       complement(1585)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:558388188"
     variation       complement(1587)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435361730"
     variation       complement(1589)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991653031"
     variation       complement(1596)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1400246504"
     variation       complement(1602)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393634741"
     variation       complement(1603..1617)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="tgggggtgggggggt"
                     /db_xref="dbSNP:919678612"
     variation       complement(1610)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:958863304"
     variation       complement(1613)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1376587494"
     variation       complement(1614)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1238469964"
     variation       complement(1615)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306569051"
     variation       complement(1616..1617)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:941419766"
     variation       complement(1616)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1035782629"
     variation       complement(1620)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254896874"
     variation       complement(1631)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983213973"
     variation       complement(1633..1634)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ga"
                     /db_xref="dbSNP:929144374"
     variation       complement(1644)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:538554683"
     variation       complement(1645)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238754095"
     variation       complement(1646)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457119418"
     variation       complement(1648)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1176563872"
     variation       complement(1649)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397052635"
     variation       complement(1660)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1248697125"
     variation       complement(1663)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:917787168"
     variation       complement(1665)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1375977852"
     variation       complement(1672)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1222348503"
     variation       complement(1674)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1358832628"
     variation       complement(1679)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1168959908"
     variation       complement(1680)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:992476195"
     STS             1681..1808
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /standard_name="RH12882"
                     /db_xref="UniSTS:56988"
     variation       complement(1682)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1444953521"
     variation       complement(1683)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1289754111"
     variation       complement(1690)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959346215"
     variation       complement(1692)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1243677637"
     variation       complement(1694)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033743246"
     variation       complement(1697)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386975834"
     variation       complement(1699)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300223049"
     variation       complement(1703)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1355817502"
     variation       complement(1706..1707)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ttc"
                     /db_xref="dbSNP:1229010506"
     variation       complement(1712)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:78296367"
     variation       complement(1717)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1317231012"
     variation       complement(1721)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:546663071"
     variation       complement(1723)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1025666667"
     variation       complement(1725)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:569905272"
     variation       complement(1726)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760872164"
     variation       complement(1727)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:530122257"
     variation       complement(1728)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1190801195"
     variation       complement(1735)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1294933004"
     variation       complement(1736)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:898445156"
     variation       complement(1744..1745)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35473892"
     variation       complement(1744)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1430333819"
     variation       complement(1750)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1020722035"
     variation       complement(1755)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1171494040"
     variation       complement(1757)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1404970657"
     variation       complement(1760)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464515135"
     variation       complement(1761)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167807993"
     variation       complement(1762)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040023623"
     STS             1765..1891
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /standard_name="WIAF-2127"
                     /db_xref="UniSTS:3692"
     variation       complement(1768)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1006771157"
     variation       complement(1774..1778)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ttcag"
                     /db_xref="dbSNP:757950075"
     variation       complement(1778)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1161206552"
     variation       complement(1795)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1457752302"
     variation       complement(1796)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1215"
     variation       complement(1798)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:551101037"
     variation       complement(1799)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:935083831"
     variation       complement(1800)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:923669811"
     variation       complement(1801)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1043431244"
     variation       complement(1811)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900100787"
     variation       complement(1818)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1216700220"
     variation       complement(1824)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946368418"
     variation       complement(1825)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1322060802"
     variation       complement(1831)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1220585287"
     variation       complement(1834)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185269004"
     variation       complement(1836)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1194739869"
     variation       complement(1840)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262550233"
     variation       complement(1841)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779497605"
     variation       complement(1844)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1266822694"
     variation       complement(1848)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1423548472"
     variation       complement(1849)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:557697234"
     variation       complement(1855)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1347388342"
     variation       complement(1856)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958914936"
     variation       complement(1860)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937900774"
     variation       complement(1861)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1489200425"
     variation       complement(1862..1863)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:926572189"
     variation       complement(1864..1865)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1397628601"
     variation       complement(1877)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:928820753"
     variation       complement(1881)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1294999988"
     variation       complement(1889..1892)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="cttt"
                     /db_xref="dbSNP:1227464068"
     variation       complement(1889..1891)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ctt"
                     /db_xref="dbSNP:1261270027"
     variation       complement(1889..1890)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:1379823454"
     variation       complement(1893..1895)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="ttt"
                     /db_xref="dbSNP:377718990"
     variation       complement(1895)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1237970476"
     regulatory      1896..1901
                     /regulatory_class="polyA_signal_sequence"
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
     regulatory      1904..1909
                     /regulatory_class="polyA_signal_sequence"
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
     variation       complement(1904)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1303217687"
     variation       complement(1905..1906)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1285625284"
     variation       complement(1906)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:565471914"
     variation       complement(1907)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1487325024"
     variation       complement(1908)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1223748449"
     variation       complement(1909..1910)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1472757533"
     variation       complement(1909)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:981552311"
     variation       complement(1911)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:913606465"
     variation       complement(1912)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:951524203"
     variation       complement(1915)
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1026141799"
     polyA_site      1924
                     /gene="CLDN7"
                     /gene_synonym="CEPTRL2; claudin-1; CLDN-7; CPETRL2;
                     Hs.84359"
ORIGIN      
ggaaaaaaaaggagagcagcgggtgggggcgaaagcagggccgaggagagagcactttggacagaacccggcggggaaagggcggcgccgaggcttgtcaggggcgccccgcagcgtcccaggcgcacctgttgggaagaaaggaaggggcttcccggtgttcgagggaaatccagtccggaggggctgactcggagcttgggactcctggggagccaccgcctcctccccagcggcggtcaaaaccgggcaagcgaaggggcgtgaccctggtgctcaggtttcttcctcctcacctgggcaaggaggggtgggggccacgacttccggttcaggtgagtgtcccttcggtgacgtcaggtcatcctcggccgcccctccggtcccgcctccccctcccgcgctcccggggcgcgcgggccgcgcccccgacgccctacatatactcaggtgcgccccacctgtccgcccgcacctgctggctcacctccgagccacctctgctgcgcaccgcagcctcggacctacagcccaggatactttgggacttgccggcgctcagaaacgcgcccagacggcccctccaccttttgtttgcctagggtcgccgagagcgcccggagggaaccgcctggccttcggggaccaccaattttgtctggaaccaccctcccggcgtatcctactccctgtgccgcgaggccatcgcttcactggaggggtcgatttgtgtgtagtttggtgacaagatttgcattcacctggcccaaaccctttttgtctctttgggtgaccggaaaactccacctcaagttttcttttgtggggctgccccccaagtgtcgtttgttttactgtagggtctccccgcccggcgcccccagtgttttctgagggcggaaatggccaattcgggcctgcagttgctgggcttctccatggccctgctgggctgggtgggtctggtggcctgcaccgccatcccgcagtggcagatgagctcctatgcgggtgacaacatcatcacggcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcacggggatgatgagctgcaaaatgtacgactcggtgctcgccctgtccgcggccttgcaggccactcgagccctaatggtggtctccctggtgctgggcttcctggccatgtttgtggccacgatgggcatgaagtgcacgcgctgtgggggagacgacaaagtgaagaaggcccgtatagccatgggtggaggcataattttcatcgtggcaggtatgagtttggccctgccatctttattggctgggcagggtctgccctagtcatcctgggaggtgcactgctctcctgttcctgtcctgggaatgagagcaaggctgggtaccgtgtaccccgctcttaccctaagtccaactcttccaaggagtatgtgtgacctgggatctccttgccccagcctgacaggctatgggagtgtctagatgcctgaaagggcctggggctgagctcagcctgtgggcagggtgccggacaaaggcctcctggtcactctgtccctgcactccatgtatagtcctcttgggttgggggtgggggggtgccgttggtgggagagacaaaaagagggagagtgtgctttttgtacagtaataaaaaataagtattgggaagcaggcttttttcccttcagggcctctgctttcctcccgtccagatccttgcagggagcttggaaccttagtgcacctacttcagttcagaacacttagcaccccactgactccactgacaattgactaaaagatgcaggtgctcgtatctcgacattcattcccacccccctcttatttaaatagctaccaaagtacttcttttttaataaaaaaataaagatttttattaggtaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]