2025-07-15 15:35:56, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001183716 579 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C Tim18p (TIM18), partial mRNA. ACCESSION NM_001183716 VERSION NM_001183716.4 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 579) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 579) AUTHORS Dujon,B., Albermann,K., Aldea,M., Alexandraki,D., Ansorge,W., Arino,J., Benes,V., Bohn,C., Bolotin-Fukuhara,M., Bordonne,R., Boyer,J., Camasses,A., Casamayor,A., Casas,C., Cheret,G., Cziepluch,C., Daignan-Fornier,B., Dang,D.V., de Haan,M., Delius,H., Durand,P., Fairhead,C., Feldmann,H., Gaillon,L., Kleine,K. et al. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome XV JOURNAL Nature 387 (6632 SUPPL), 98-102 (1997) PUBMED 9169874 REFERENCE 3 (bases 1 to 579) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 579) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 579) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (16-JAN-2015) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 579) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 7 (bases 1 to 579) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 8 (bases 1 to 579) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (27-MAY-2010) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 9 (bases 1 to 579) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001147). On Jul 30, 2012 this sequence version replaced NM_001183716.3. ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..579 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="XV" gene <1..>579 /gene="TIM18" /locus_tag="YOR297C" /db_xref="GeneID:854472" CDS 1..579 /gene="TIM18" /locus_tag="YOR297C" /experiment="EXISTENCE:direct assay:GO:0005739 mitochondrion [PMID:16823961]" /experiment="EXISTENCE:direct assay:GO:0008320 protein transmembrane transporter activity [PMID:12637749]" /experiment="EXISTENCE:direct assay:GO:0042721 TIM22 mitochondrial import inner membrane insertion complex [PMID:10648604|PMID:10637294]" /experiment="EXISTENCE:genetic interaction:GO:0045039 protein insertion into mitochondrial inner membrane [PMID:10637294]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17922641]" /experiment="EXISTENCE:mutant phenotype:GO:0006970 response to osmotic stress [PMID:17922641]" /experiment="EXISTENCE:mutant phenotype:GO:0034599 cellular response to oxidative stress [PMID:17922641]" /experiment="EXISTENCE:mutant phenotype:GO:0046685 response to arsenic-containing substance [PMID:17922641]" /note="Component of the mitochondrial TIM22 complex; involved in insertion of polytopic proteins into the inner membrane; may mediate assembly or stability of the complex" /codon_start=1 /product="Tim18p" /protein_id="NP_014940.4" /db_xref="GeneID:854472" /db_xref="SGD:S000005823" /translation="
MLLFPGLKPVLNASTVIVNPVRAVFPGLVLSTKRSFYSINRLNAENKINDIANTSKEASSSVQMFKPPEFSQFKDSYQKDYERIAKYTLIPLTMVPFYASFTGGVINPLLDASLSSIFLIYLQYGFTSCIIDYIPKEKYPRWHKLALYCLYGGSMLSLYGIYELETKNNGFVDLVKKLWNENDDHLYIFGRN"
misc_feature 139..540 /gene="TIM18" /locus_tag="YOR297C" /note="succinate dehydrogenase cytochrome B small subunit; Region: CybS; pfam05328" /db_xref="CDD:461624" ORIGIN
atgctattgtttcctggcttgaagcctgttcttaatgcttccactgtcattgtaaatcctgtacgagctgtttttccaggattagtactttcaaccaaaagatccttttatagcattaatcgtttaaatgctgaaaataaaataaacgatattgcaaatacgtcaaaagaggcatcctcttcagtgcagatgtttaagcccccagagttctctcaatttaaggactcttatcaaaaagactatgagagaatagcaaaatatactttgattccattaacaatggtacctttttatgcctcctttaccggcggggttataaatcctttactcgatgcgtctttatcgtccatttttttgatatatttacagtatggcttcacaagttgtattattgactatataccgaaggaaaagtatccaagatggcataagctcgccctttattgcctctatggaggatccatgttgtccctgtacggtatctacgaattggaaacgaaaaataatggttttgttgacctggtaaagaaactttggaatgaaaatgatgaccatttgtatatatttggaagaaactga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]