LOCUS       NM_001183716             579 bp    mRNA    linear   PLN 15-SEP-2023
DEFINITION  Saccharomyces cerevisiae S288C Tim18p (TIM18), partial mRNA.
ACCESSION   NM_001183716
VERSION     NM_001183716.4
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 579)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 579)
  AUTHORS   Dujon,B., Albermann,K., Aldea,M., Alexandraki,D., Ansorge,W.,
            Arino,J., Benes,V., Bohn,C., Bolotin-Fukuhara,M., Bordonne,R.,
            Boyer,J., Camasses,A., Casamayor,A., Casas,C., Cheret,G.,
            Cziepluch,C., Daignan-Fornier,B., Dang,D.V., de Haan,M., Delius,H.,
            Durand,P., Fairhead,C., Feldmann,H., Gaillon,L., Kleine,K. et al.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome XV
  JOURNAL   Nature 387 (6632 SUPPL), 98-102 (1997)
   PUBMED   9169874
REFERENCE   3  (bases 1 to 579)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 579)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-SEP-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 579)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2015) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 579)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   7  (bases 1 to 579)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   8  (bases 1 to 579)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAY-2010) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   9  (bases 1 to 579)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001147).
            
            On Jul 30, 2012 this sequence version replaced NM_001183716.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..579
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="XV"
     gene            <1..>579
                     /gene="TIM18"
                     /locus_tag="YOR297C"
                     /db_xref="GeneID:854472"
     CDS             1..579
                     /gene="TIM18"
                     /locus_tag="YOR297C"
                     /experiment="EXISTENCE:direct assay:GO:0005739
                     mitochondrion [PMID:16823961]"
                     /experiment="EXISTENCE:direct assay:GO:0008320 protein
                     transmembrane transporter activity [PMID:12637749]"
                     /experiment="EXISTENCE:direct assay:GO:0042721 TIM22
                     mitochondrial import inner membrane insertion complex
                     [PMID:10648604|PMID:10637294]"
                     /experiment="EXISTENCE:genetic interaction:GO:0045039
                     protein insertion into mitochondrial inner membrane
                     [PMID:10637294]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006915
                     apoptotic process [PMID:17922641]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006970
                     response to osmotic stress [PMID:17922641]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0034599
                     cellular response to oxidative stress [PMID:17922641]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0046685
                     response to arsenic-containing substance [PMID:17922641]"
                     /note="Component of the mitochondrial TIM22 complex;
                     involved in insertion of polytopic proteins into the inner
                     membrane; may mediate assembly or stability of the
                     complex"
                     /codon_start=1
                     /product="Tim18p"
                     /protein_id="NP_014940.4"
                     /db_xref="GeneID:854472"
                     /db_xref="SGD:S000005823"
                     /translation="

MLLFPGLKPVLNASTVIVNPVRAVFPGLVLSTKRSFYSINRLNAENKINDIANTSKEASSSVQMFKPPEFSQFKDSYQKDYERIAKYTLIPLTMVPFYASFTGGVINPLLDASLSSIFLIYLQYGFTSCIIDYIPKEKYPRWHKLALYCLYGGSMLSLYGIYELETKNNGFVDLVKKLWNENDDHLYIFGRN"

     misc_feature    139..540
                     /gene="TIM18"
                     /locus_tag="YOR297C"
                     /note="succinate dehydrogenase cytochrome B small subunit;
                     Region: CybS; pfam05328"
                     /db_xref="CDD:428425"
     misc_feature    order(217..219,223..228,382..384,391..396,403..405)
                     /gene="TIM18"
                     /locus_tag="YOR297C"
                     /note="Iron-sulfur protein interface [active]"
                     /db_xref="CDD:239576"
     misc_feature    order(247..249,394..399,469..471,478..480,487..489,
                     502..504,520..522,535..537)
                     /gene="TIM18"
                     /locus_tag="YOR297C"
                     /note="CybL subunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239576"
     misc_feature    order(286..291,526..528,535..537)
                     /gene="TIM18"
                     /locus_tag="YOR297C"
                     /note="distal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239576"
     misc_feature    order(361..363,373..375)
                     /gene="TIM18"
                     /locus_tag="YOR297C"
                     /note="proximal heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239576"
     misc_feature    397..399
                     /gene="TIM18"
                     /locus_tag="YOR297C"
                     /note="proximal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239576"
ORIGIN      

atgctattgtttcctggcttgaagcctgttcttaatgcttccactgtcattgtaaatcctgtacgagctgtttttccaggattagtactttcaaccaaaagatccttttatagcattaatcgtttaaatgctgaaaataaaataaacgatattgcaaatacgtcaaaagaggcatcctcttcagtgcagatgtttaagcccccagagttctctcaatttaaggactcttatcaaaaagactatgagagaatagcaaaatatactttgattccattaacaatggtacctttttatgcctcctttaccggcggggttataaatcctttactcgatgcgtctttatcgtccatttttttgatatatttacagtatggcttcacaagttgtattattgactatataccgaaggaaaagtatccaagatggcataagctcgccctttattgcctctatggaggatccatgttgtccctgtacggtatctacgaattggaaacgaaaaataatggttttgttgacctggtaaagaaactttggaatgaaaatgatgaccatttgtatatatttggaagaaactga

//