2024-05-06 02:52:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001183143 894 bp mRNA linear PLN 15-SEP-2023 DEFINITION Saccharomyces cerevisiae S288C Bxi1p (BXI1), partial mRNA. ACCESSION NM_001183143 VERSION NM_001183143.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 894) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 894) AUTHORS Philippsen,P., Kleine,K., Pohlmann,R., Dusterhoft,A., Hamberg,K., Hegemann,J.H., Obermaier,B., Urrestarazu,L.A., Aert,R., Albermann,K., Altmann,R., Andre,B., Baladron,V., Ballesta,J.P., Becam,A.M., Beinhauer,J., Boskovic,J., Buitrago,M.J., Bussereau,F., Coster,F., Crouzet,M., D'Angelo,M., Dal Pero,F., De Antoni,A., Hani,J. et al. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications JOURNAL Nature 387 (6632 SUPPL), 93-98 (1997) PUBMED 9169873 REFERENCE 3 (bases 1 to 894) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 894) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (14-SEP-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 894) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 894) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 894) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (26-MAY-2010) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 8 (bases 1 to 894) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001146). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..894 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="XIV" gene <1..>894 /gene="BXI1" /locus_tag="YNL305C" /gene_synonym="YBH3" /db_xref="GeneID:855411" CDS 1..894 /gene="BXI1" /locus_tag="YNL305C" /gene_synonym="YBH3" /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type vacuole [PMID:14562095|PMID:21673659|PMID:21673967|PMID:26928762]" /experiment="EXISTENCE:direct assay:GO:0005739 mitochondrion [PMID:21673659]" /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic reticulum [PMID:21673967]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:21673659|PMID:21673967]" /experiment="EXISTENCE:mutant phenotype:GO:0019722 calcium-mediated signaling [PMID:21673967]" /experiment="EXISTENCE:mutant phenotype:GO:0030968 endoplasmic reticulum unfolded protein response [PMID:21673967]" /note="Protein involved in apoptosis; variously described as containing a BCL-2 homology (BH3) domain or as a member of the BAX inhibitor family; reported to promote apoptosis under some conditions and to inhibit it in others; localizes to ER and vacuole; may link the unfolded protein response to apoptosis via regulation of calcium-mediated signaling; translocates to mitochondria under apoptosis-inducing conditions in a process involving Mir1p and Cor1p" /codon_start=1 /product="Bxi1p" /protein_id="NP_014094.1" /db_xref="GeneID:855411" /db_xref="SGD:S000005249" /translation="
MSGPPPPYEEQSSHLYGQPASSQDGNAFIPEDFKYSTVVISCEPIIRQRFMHKVYSLLSCQLLASLSFCYWASVSTSLQNFIMSHIALFYICMVVSLVSCIWLAVSPRPEDYEASVPEPLLTGSSEEPAQEQRRLPWYVLSSYKQKLTLLSIFTLSEAYCLSLVTLAYDKDTVLSALLITTIVVVGVSLTALSERFENVLNSATSIYYWLNWGLWIMIGMGLTALLFGWNTHSSKFNLLYGWLGAILFTAYLFIDTQLIFRKVYPDEEVRCAMMLYLDIVNLFLSILRILANSNDDN"
misc_feature 61..882 /gene="BXI1" /locus_tag="YNL305C" /gene_synonym="YBH3" /note="Golgi antiapoptotic protein; Region: GAAP_like; cd10429" /db_xref="CDD:198411" ORIGIN
atgtcaggtcctccacctccttacgaagagcaaagctcacatctttacggccagcctgcgagcagccaggatggaaacgctttcatcccggaagactttaaatattccacggtggttatctcgtgcgaacccatcattcgccagcggtttatgcacaaggtttactctctgctgtcatgccagttactggccagtttgtcgttctgctactgggctagcgtttccacttctttgcagaactttatcatgtcgcatatcgccctcttctacatctgcatggtggtatcgctagtatcgtgcatttggctggcagtaagtcctcgtcccgaagactacgaggccagtgttcccgaaccgttgctcacgggcagcagcgaagagccggcacaagagcaaaggcgtctgccttggtacgtcttgtcctcgtacaagcaaaagctcacgctgctctccattttcactctttccgaggcttactgtctgtcgctggtaaccttagcgtacgataaggatacagtactttcggctctgctgatcaccaccatcgtcgtagtcggcgtttccttgaccgcactatcagagagattcgagaacgtgctgaattccgcaacgtcaatatactattggttaaactggggtctatggattatgatcggaatgggtctcacggccttgcttttcggctggaatacccactcttccaagtttaatctgctttacggctggcttggtgccattttatttaccgcgtatcttttcatcgatacgcaactgatttttaggaaagtgtatcctgatgaagaagttagatgcgccatgatgctttacctggacatcgtcaatttgtttttgtctattttaaggattttggccaactctaacgacgacaattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]