GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 02:52:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001183143             894 bp    mRNA    linear   PLN 15-SEP-2023
DEFINITION  Saccharomyces cerevisiae S288C Bxi1p (BXI1), partial mRNA.
ACCESSION   NM_001183143
VERSION     NM_001183143.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 894)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 894)
  AUTHORS   Philippsen,P., Kleine,K., Pohlmann,R., Dusterhoft,A., Hamberg,K.,
            Hegemann,J.H., Obermaier,B., Urrestarazu,L.A., Aert,R.,
            Albermann,K., Altmann,R., Andre,B., Baladron,V., Ballesta,J.P.,
            Becam,A.M., Beinhauer,J., Boskovic,J., Buitrago,M.J., Bussereau,F.,
            Coster,F., Crouzet,M., D'Angelo,M., Dal Pero,F., De Antoni,A.,
            Hani,J. et al.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV
            and its evolutionary implications
  JOURNAL   Nature 387 (6632 SUPPL), 93-98 (1997)
   PUBMED   9169873
REFERENCE   3  (bases 1 to 894)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 894)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-SEP-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 894)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 894)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 894)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (26-MAY-2010) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   8  (bases 1 to 894)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001146).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..894
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="XIV"
     gene            <1..>894
                     /gene="BXI1"
                     /locus_tag="YNL305C"
                     /gene_synonym="YBH3"
                     /db_xref="GeneID:855411"
     CDS             1..894
                     /gene="BXI1"
                     /locus_tag="YNL305C"
                     /gene_synonym="YBH3"
                     /experiment="EXISTENCE:direct assay:GO:0000324 fungal-type
                     vacuole
                     [PMID:14562095|PMID:21673659|PMID:21673967|PMID:26928762]"
                     /experiment="EXISTENCE:direct assay:GO:0005739
                     mitochondrion [PMID:21673659]"
                     /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
                     reticulum [PMID:21673967]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006915
                     apoptotic process [PMID:21673659|PMID:21673967]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0019722
                     calcium-mediated signaling [PMID:21673967]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0030968
                     endoplasmic reticulum unfolded protein response
                     [PMID:21673967]"
                     /note="Protein involved in apoptosis; variously described
                     as containing a BCL-2 homology (BH3) domain or as a member
                     of the BAX inhibitor family; reported to promote apoptosis
                     under some conditions and to inhibit it in others;
                     localizes to ER and vacuole; may link the unfolded protein
                     response to apoptosis via regulation of calcium-mediated
                     signaling; translocates to mitochondria under
                     apoptosis-inducing conditions in a process involving Mir1p
                     and Cor1p"
                     /codon_start=1
                     /product="Bxi1p"
                     /protein_id="NP_014094.1"
                     /db_xref="GeneID:855411"
                     /db_xref="SGD:S000005249"
                     /translation="
MSGPPPPYEEQSSHLYGQPASSQDGNAFIPEDFKYSTVVISCEPIIRQRFMHKVYSLLSCQLLASLSFCYWASVSTSLQNFIMSHIALFYICMVVSLVSCIWLAVSPRPEDYEASVPEPLLTGSSEEPAQEQRRLPWYVLSSYKQKLTLLSIFTLSEAYCLSLVTLAYDKDTVLSALLITTIVVVGVSLTALSERFENVLNSATSIYYWLNWGLWIMIGMGLTALLFGWNTHSSKFNLLYGWLGAILFTAYLFIDTQLIFRKVYPDEEVRCAMMLYLDIVNLFLSILRILANSNDDN"
     misc_feature    61..882
                     /gene="BXI1"
                     /locus_tag="YNL305C"
                     /gene_synonym="YBH3"
                     /note="Golgi antiapoptotic protein; Region: GAAP_like;
                     cd10429"
                     /db_xref="CDD:198411"
ORIGIN      
atgtcaggtcctccacctccttacgaagagcaaagctcacatctttacggccagcctgcgagcagccaggatggaaacgctttcatcccggaagactttaaatattccacggtggttatctcgtgcgaacccatcattcgccagcggtttatgcacaaggtttactctctgctgtcatgccagttactggccagtttgtcgttctgctactgggctagcgtttccacttctttgcagaactttatcatgtcgcatatcgccctcttctacatctgcatggtggtatcgctagtatcgtgcatttggctggcagtaagtcctcgtcccgaagactacgaggccagtgttcccgaaccgttgctcacgggcagcagcgaagagccggcacaagagcaaaggcgtctgccttggtacgtcttgtcctcgtacaagcaaaagctcacgctgctctccattttcactctttccgaggcttactgtctgtcgctggtaaccttagcgtacgataaggatacagtactttcggctctgctgatcaccaccatcgtcgtagtcggcgtttccttgaccgcactatcagagagattcgagaacgtgctgaattccgcaacgtcaatatactattggttaaactggggtctatggattatgatcggaatgggtctcacggccttgcttttcggctggaatacccactcttccaagtttaatctgctttacggctggcttggtgccattttatttaccgcgtatcttttcatcgatacgcaactgatttttaggaaagtgtatcctgatgaagaagttagatgcgccatgatgctttacctggacatcgtcaatttgtttttgtctattttaaggattttggccaactctaacgacgacaattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]