2025-07-15 15:47:31, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001183018 996 bp mRNA linear PLN 17-DEC-2024 DEFINITION Saccharomyces cerevisiae S288C Rho family GTPase RHO5 (RHO5), partial mRNA. ACCESSION NM_001183018 VERSION NM_001183018.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 996) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 996) AUTHORS Philippsen,P., Kleine,K., Pohlmann,R., Dusterhoft,A., Hamberg,K., Hegemann,J.H., Obermaier,B., Urrestarazu,L.A., Aert,R., Albermann,K., Altmann,R., Andre,B., Baladron,V., Ballesta,J.P., Becam,A.M., Beinhauer,J., Boskovic,J., Buitrago,M.J., Bussereau,F., Coster,F., Crouzet,M., D'Angelo,M., Dal Pero,F., De Antoni,A., Hani,J. et al. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications JOURNAL Nature 387 (6632 SUPPL), 93-98 (1997) PUBMED 9169873 REFERENCE 3 (bases 1 to 996) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 996) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (17-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 996) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 996) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 996) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (26-MAY-2010) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 8 (bases 1 to 996) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001146). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..996 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="XIV" gene <1..>996 /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /db_xref="GeneID:855541" CDS 1..996 /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type vacuole membrane [PMID:18216266]" /experiment="EXISTENCE:direct assay:GO:0003924 GTPase activity [PMID:11591390]" /experiment="EXISTENCE:direct assay:GO:0005634 nucleus [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm [PMID:14562095]" /experiment="EXISTENCE:direct assay:GO:0005886 plasma membrane [PMID:18216266]" /experiment="EXISTENCE:direct assay:GO:0012505 endomembrane system [PMID:18216266]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:18216266]" /experiment="EXISTENCE:mutant phenotype:GO:0034599 cellular response to oxidative stress [PMID:18216266]" /note="Non-essential small GTPase of the Rho/Rac family of Ras-like proteins; regulated by phosphorylation and ubiquitination; likely involved in protein kinase C (Pkc1p)-dependent signal transduction pathway that controls cell integrity; necessary for oxidant and ramped heat stress-induced cell death; ortholog of mammalian RAC1" /codon_start=1 /product="Rho family GTPase RHO5" /protein_id="NP_014219.1" /db_xref="GeneID:855541" /db_xref="SGD:S000005124" /translation="
MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNGNDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASFANVTEKWLPELKQTSNIEGTSLYTKLGKYPILLVGTKSDLRDDPATQKKLQEANSDYVSQEEIDELVQRCGFMGYTECSAATQAGVREVFEQAVRYAIYEPESPNQKSANHTLTDELTTATTNTNGDKNIREQKQQPHHNNSTDSTLPKGSLQQEKEALNIKPTKKGQKDKIHEQSKSKGSKIASNNHHNKQAKPKTRNDKKKKKSKCVIL"
misc_feature order(13..15,103..108,112..117,121..123,127..129,244..246, 256..273,289..291,298..300) /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="GEF (guanine nucleotide exchange factor) interaction site [polypeptide binding]; other site" /db_xref="CDD:206641" misc_feature 16..660 /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="Rho (Ras homology) subfamily of Ras-like small GTPases; Region: RHO; smart00174" /db_xref="CDD:197554" misc_feature 28..51 /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="G1 box; other site" /db_xref="CDD:206641" misc_feature order(37..54,103..105,259..264,469..471,475..477,598..603) /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206641" misc_feature order(100..102,106..111,271..273,289..291,298..300) /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="GAP (GTPase-activating protein) interaction site [polypeptide binding]; other site" /db_xref="CDD:206641" misc_feature order(103..108,265..267,289..291,295..300) /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="GDI (guanine nucleotide dissociation inhibitor) interaction site [polypeptide binding]; other site" /db_xref="CDD:206641" misc_feature 103..105 /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="G2 box; other site" /db_xref="CDD:206641" misc_feature 106..120 /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="Switch I region; other site" /db_xref="CDD:206641" misc_feature order(109..111,289..291,298..300) /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="effector interaction site [active]" /db_xref="CDD:206641" misc_feature 259..270 /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="G3 box; other site" /db_xref="CDD:206641" misc_feature order(265..273,289..300,313..321) /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="Switch II region; other site" /db_xref="CDD:206641" misc_feature 466..477 /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="G4 box; other site" /db_xref="CDD:206641" misc_feature 595..603 /gene="RHO5" /locus_tag="YNL180C" /gene_synonym="YNS0" /note="G5 box; other site" /db_xref="CDD:206641" ORIGIN
atgaggtctattaaatgtgtgataattggtgatggtgcagtaggtaaaacgtcacttctaatatcatatactaccaattcgttcccaacagactatgttccaacggtttttgataattattctactacgatagctatcccgaacggaactgcgagtagccccctagagcttgacaatggtaatgataaaagaggttcactttcatctgccagttcttcaccaagtacggacagaaaactatataaaatcaatttatgggacactgcaggacaggaagattacgatcgtttaagaccgttatgttatccccaaacagatatttttttaatatgtttctcagtaagcgaacatgctagttttgccaatgtcacagaaaaatggctacctgaactgaagcagacttccaatattgaaggtacctctctttatactaaattagggaagtatccaattctattggtaggcaccaaaagtgacctaagagatgatccggcaactcagaaaaaattgcaggaagcaaactccgattacgtgtctcaagaggaaatagatgaactcgtacaaagatgtgggtttatgggctataccgaatgttcagctgctacccaagcaggtgtccgggaagtctttgaacaggcggtgaggtacgctatctacgaaccagaatcccctaaccaaaaatcagcaaatcatactctaactgatgaattaacgactgcaacaaccaacaccaatggagataaaaatattcgagaacaaaaacagcaaccacaccataataatagtacagatagtactcttccgaaaggaagcttacagcaggagaaggaagctctcaatatcaaacccacaaaaaagggacaaaaagacaaaattcacgagcaatcaaaaagcaaaggtagtaaaattgcctcaaataatcatcacaacaagcaagctaaaccaaagacgagaaacgacaagaagaaaaagaagtcaaagtgtgtaatactttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]