GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 23:20:21, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001183018             996 bp    mRNA    linear   PLN 15-SEP-2023
DEFINITION  Saccharomyces cerevisiae S288C Rho family GTPase RHO5 (RHO5),
            partial mRNA.
ACCESSION   NM_001183018
VERSION     NM_001183018.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 996)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 996)
  AUTHORS   Philippsen,P., Kleine,K., Pohlmann,R., Dusterhoft,A., Hamberg,K.,
            Hegemann,J.H., Obermaier,B., Urrestarazu,L.A., Aert,R.,
            Albermann,K., Altmann,R., Andre,B., Baladron,V., Ballesta,J.P.,
            Becam,A.M., Beinhauer,J., Boskovic,J., Buitrago,M.J., Bussereau,F.,
            Coster,F., Crouzet,M., D'Angelo,M., Dal Pero,F., De Antoni,A.,
            Hani,J. et al.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV
            and its evolutionary implications
  JOURNAL   Nature 387 (6632 SUPPL), 93-98 (1997)
   PUBMED   9169873
REFERENCE   3  (bases 1 to 996)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 996)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-SEP-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 996)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 996)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 996)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (26-MAY-2010) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   8  (bases 1 to 996)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001146).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..996
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="XIV"
     gene            <1..>996
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /db_xref="GeneID:855541"
     CDS             1..996
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /experiment="EXISTENCE:direct assay:GO:0000329 fungal-type
                     vacuole membrane [PMID:18216266]"
                     /experiment="EXISTENCE:direct assay:GO:0003924 GTPase
                     activity [PMID:11591390]"
                     /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
                     [PMID:14562095]"
                     /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
                     [PMID:14562095]"
                     /experiment="EXISTENCE:direct assay:GO:0005886 plasma
                     membrane [PMID:18216266]"
                     /experiment="EXISTENCE:direct assay:GO:0012505
                     endomembrane system [PMID:18216266]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006915
                     apoptotic process [PMID:18216266]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0034599
                     cellular response to oxidative stress [PMID:18216266]"
                     /note="Non-essential small GTPase of the Rho/Rac family of
                     Ras-like proteins; regulated by phosphorylation and
                     ubiquitination; likely involved in protein kinase C
                     (Pkc1p)-dependent signal transduction pathway that
                     controls cell integrity; necessary for oxidant and ramped
                     heat stress-induced cell death; ortholog of mammalian
                     RAC1"
                     /codon_start=1
                     /product="Rho family GTPase RHO5"
                     /protein_id="NP_014219.1"
                     /db_xref="GeneID:855541"
                     /db_xref="SGD:S000005124"
                     /translation="
MRSIKCVIIGDGAVGKTSLLISYTTNSFPTDYVPTVFDNYSTTIAIPNGTASSPLELDNGNDKRGSLSSASSSPSTDRKLYKINLWDTAGQEDYDRLRPLCYPQTDIFLICFSVSEHASFANVTEKWLPELKQTSNIEGTSLYTKLGKYPILLVGTKSDLRDDPATQKKLQEANSDYVSQEEIDELVQRCGFMGYTECSAATQAGVREVFEQAVRYAIYEPESPNQKSANHTLTDELTTATTNTNGDKNIREQKQQPHHNNSTDSTLPKGSLQQEKEALNIKPTKKGQKDKIHEQSKSKGSKIASNNHHNKQAKPKTRNDKKKKKSKCVIL"
     misc_feature    order(13..15,103..108,112..117,121..123,127..129,244..246,
                     256..273,289..291,298..300)
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="GEF (guanine nucleotide exchange factor)
                     interaction site [polypeptide binding]; other site"
                     /db_xref="CDD:206641"
     misc_feature    16..660
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="Rho (Ras homology) subfamily of Ras-like small
                     GTPases; Region: RHO; smart00174"
                     /db_xref="CDD:197554"
     misc_feature    28..51
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="G1 box; other site"
                     /db_xref="CDD:206641"
     misc_feature    order(37..54,103..105,259..264,469..471,475..477,598..603)
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206641"
     misc_feature    order(100..102,106..111,271..273,289..291,298..300)
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="GAP (GTPase-activating protein) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:206641"
     misc_feature    order(103..108,265..267,289..291,295..300)
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="GDI (guanine nucleotide dissociation inhibitor)
                     interaction site [polypeptide binding]; other site"
                     /db_xref="CDD:206641"
     misc_feature    103..105
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="G2 box; other site"
                     /db_xref="CDD:206641"
     misc_feature    106..120
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206641"
     misc_feature    order(109..111,289..291,298..300)
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="effector interaction site [active]"
                     /db_xref="CDD:206641"
     misc_feature    259..270
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="G3 box; other site"
                     /db_xref="CDD:206641"
     misc_feature    order(265..273,289..300,313..321)
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206641"
     misc_feature    466..477
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="G4 box; other site"
                     /db_xref="CDD:206641"
     misc_feature    <481..>948
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="PAB1-binding protein PBP1, interacts with
                     poly(A)-binding protein [RNA processing and modification];
                     Region: PBP1; COG5180"
                     /db_xref="CDD:227507"
     misc_feature    595..603
                     /gene="RHO5"
                     /locus_tag="YNL180C"
                     /gene_synonym="YNS0"
                     /note="G5 box; other site"
                     /db_xref="CDD:206641"
ORIGIN      
atgaggtctattaaatgtgtgataattggtgatggtgcagtaggtaaaacgtcacttctaatatcatatactaccaattcgttcccaacagactatgttccaacggtttttgataattattctactacgatagctatcccgaacggaactgcgagtagccccctagagcttgacaatggtaatgataaaagaggttcactttcatctgccagttcttcaccaagtacggacagaaaactatataaaatcaatttatgggacactgcaggacaggaagattacgatcgtttaagaccgttatgttatccccaaacagatatttttttaatatgtttctcagtaagcgaacatgctagttttgccaatgtcacagaaaaatggctacctgaactgaagcagacttccaatattgaaggtacctctctttatactaaattagggaagtatccaattctattggtaggcaccaaaagtgacctaagagatgatccggcaactcagaaaaaattgcaggaagcaaactccgattacgtgtctcaagaggaaatagatgaactcgtacaaagatgtgggtttatgggctataccgaatgttcagctgctacccaagcaggtgtccgggaagtctttgaacaggcggtgaggtacgctatctacgaaccagaatcccctaaccaaaaatcagcaaatcatactctaactgatgaattaacgactgcaacaaccaacaccaatggagataaaaatattcgagaacaaaaacagcaaccacaccataataatagtacagatagtactcttccgaaaggaagcttacagcaggagaaggaagctctcaatatcaaacccacaaaaaagggacaaaaagacaaaattcacgagcaatcaaaaagcaaaggtagtaaaattgcctcaaataatcatcacaacaagcaagctaaaccaaagacgagaaacgacaagaagaaaaagaagtcaaagtgtgtaatactttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]