LOCUS       NM_001182894             852 bp    mRNA    linear   PLN 15-SEP-2023
DEFINITION  Saccharomyces cerevisiae S288C porin POR1 (POR1), partial mRNA.
ACCESSION   NM_001182894
VERSION     NM_001182894.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 852)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 852)
  AUTHORS   Philippsen,P., Kleine,K., Pohlmann,R., Dusterhoft,A., Hamberg,K.,
            Hegemann,J.H., Obermaier,B., Urrestarazu,L.A., Aert,R.,
            Albermann,K., Altmann,R., Andre,B., Baladron,V., Ballesta,J.P.,
            Becam,A.M., Beinhauer,J., Boskovic,J., Buitrago,M.J., Bussereau,F.,
            Coster,F., Crouzet,M., D'Angelo,M., Dal Pero,F., De Antoni,A.,
            Hani,J. et al.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV
            and its evolutionary implications
  JOURNAL   Nature 387 (6632 SUPPL), 93-98 (1997)
   PUBMED   9169873
REFERENCE   3  (bases 1 to 852)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 852)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-SEP-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 852)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 852)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 852)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (26-MAY-2010) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   8  (bases 1 to 852)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001146).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..852
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="XIV"
     gene            <1..>852
                     /gene="POR1"
                     /locus_tag="YNL055C"
                     /gene_synonym="OMP2"
                     /db_xref="GeneID:855669"
     CDS             1..852
                     /gene="POR1"
                     /locus_tag="YNL055C"
                     /gene_synonym="OMP2"
                     /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
                     [PMID:22842922]"
                     /experiment="EXISTENCE:direct assay:GO:0005739
                     mitochondrion [PMID:16823961|PMID:24769239]"
                     /experiment="EXISTENCE:direct assay:GO:0005741
                     mitochondrial outer membrane
                     [PMID:16407407|PMID:16689936|PMID:7499333]"
                     /experiment="EXISTENCE:direct assay:GO:0006811 monoatomic
                     ion transport [PMID:9593723]"
                     /experiment="EXISTENCE:direct assay:GO:0008308
                     voltage-gated monoatomic anion channel activity
                     [PMID:9593723]"
                     /experiment="EXISTENCE:direct assay:GO:0048039 ubiquinone
                     binding [PMID:28051849]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006915
                     apoptotic process [PMID:17822411]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0007005
                     mitochondrion organization [PMID:11488609]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0042307
                     positive regulation of protein import into nucleus
                     [PMID:29359182]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0045454 cell
                     redox homeostasis [PMID:18768136]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0051027 DNA
                     transport [PMID:19056337]"
                     /experiment="EXISTENCE:physical interaction:GO:0005739
                     mitochondrion [PMID:16962558]"
                     /experiment="EXISTENCE:physical interaction:GO:0044289
                     mitochondrial inner-outer membrane contact site
                     [PMID:37073556]"
                     /note="Mitochondrial porin (voltage-dependent anion
                     channel); outer membrane protein required for maintenance
                     of mitochondrial osmotic stability and mitochondrial
                     membrane permeability; couples the glutathione pools of
                     the intermembrane space (IMS) and the cytosol; interacts
                     with Om45 and Om14 in the outer membrane; phosphorylated;
                     protein abundance increases in response to DNA replication
                     stress"
                     /codon_start=1
                     /product="porin POR1"
                     /protein_id="NP_014343.1"
                     /db_xref="GeneID:855669"
                     /db_xref="SGD:S000005000"
                     /translation="

MSPPVYSDISRNINDLLNKDFYHATPAAFDVQTTTANGIKFSLKAKQPVKDGPLSTNVEAKLNDKQTGLGLTQGWSNTNNLQTKLEFANLTPGLKNELITSLTPGVAKSAVLNTTFTQPFFTARGAFDLCLKSPTFVGDLTMAHEGIVGGAEFGYDISAGSISRYAMALSYFAKDYSLGATLNNEQITTVDFFQNVNAFLQVGAKATMNCKLPNSNVNIEFATRYLPDASSQVKAKVSDSGIVTLAYKQLLRPGVTLGVGSSFDALKLSEPVHKLGWSLSFDA"

     misc_feature    7..846
                     /gene="POR1"
                     /locus_tag="YNL055C"
                     /gene_synonym="OMP2"
                     /note="Voltage-dependent anion channel of the outer
                     mitochondrial membrane; Region: Porin3_VDAC; cd07306"
                     /db_xref="CDD:132767"
     misc_feature    order(43..45,55..57,136..138,181..183,250..252,454..456,
                     844..846)
                     /gene="POR1"
                     /locus_tag="YNL055C"
                     /gene_synonym="OMP2"
                     /note="putative determinants of voltage gating [active]"
                     /db_xref="CDD:132767"
     misc_feature    order(79..81,85..87,769..771,775..777,829..831)
                     /gene="POR1"
                     /locus_tag="YNL055C"
                     /gene_synonym="OMP2"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:132767"
ORIGIN      

atgtctcctccagtttacagcgatatctccagaaatatcaatgacctattgaacaaggatttctatcatgctaccccagctgcctttgatgtgcaaacaacaaccgccaatggcattaagttctcattgaaggctaaacagcctgtcaaagacggtccactgtctactaacgtggaagcaaagttgaatgacaagcaaaccggcttgggtctaactcaaggctggtctaacacaaacaacttgcaaaccaaattagagtttgccaacttgacccctggtctaaagaacgaattgatcacttctttgactccaggcgtcgccaagtccgccgtcttaaacactacgttcacacaacctttcttcaccgcaagaggtgcctttgacttgtgtttgaagtcaccaacatttgttggtgacttaactatggcccacgaaggtattgttggtggcgcagagtttggttacgatatcagcgccggttccatttctcgttatgccatggctttaagttatttcgccaaagactactccttgggcgctacattgaacaacgagcaaataactaccgttgacttcttccaaaacgtcaacgcctttttacaggtcggtgctaaggctacaatgaactgcaaactacctaactccaatgtcaacatcgaattcgccactagatatttgcctgatgcatcttcccaagttaaggctaaggtgtccgattccggtattgtcactttggcttacaagcaattgttaagacctggcgtcactctgggtgtcggttcctctttcgatgctttgaagttgtctgaacctgttcacaagctaggttggtctttgtccttcgacgcttga

//