LOCUS       NM_001182701             303 bp    mRNA    linear   PLN 30-JUN-2025
DEFINITION  Saccharomyces cerevisiae S288C 60S ribosomal protein eL36 RPL36A
            (RPL36A), partial mRNA.
ACCESSION   NM_001182701
VERSION     NM_001182701.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 303)
  AUTHORS   Bowman,S., Churcher,C., Badcock,K., Brown,D., Chillingworth,T.,
            Connor,R., Dedman,K., Devlin,K., Gentles,S., Hamlin,N., Hunt,S.,
            Jagels,K., Lye,G., Moule,S., Odell,C., Pearson,D., Rajandream,M.,
            Rice,P., Skelton,J., Walsh,S., Whitehead,S. and Barrell,B.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII
  JOURNAL   Nature 387 (6632 SUPPL), 90-93 (1997)
   PUBMED   9169872
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUN-2025) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 303)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 303)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 303)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001145).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="XIII"
     gene            <1..>303
                     /gene="RPL36A"
                     /locus_tag="YMR194W"
                     /gene_synonym="RPL39B"
                     /db_xref="GeneID:855232"
     CDS             1..303
                     /gene="RPL36A"
                     /locus_tag="YMR194W"
                     /gene_synonym="RPL39B"
                     /experiment="EXISTENCE:direct assay:GO:0002181 cytoplasmic
                     translation [PMID:18782943]"
                     /experiment="EXISTENCE:direct assay:GO:0003723 RNA binding
                     [PMID:6337137]"
                     /experiment="EXISTENCE:direct assay:GO:0003735 structural
                     constituent of ribosome [PMID:18782943]"
                     /experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
                     large ribosomal subunit [PMID:18782943]"
                     /note="Ribosomal 60S subunit protein L36A; N-terminally
                     acetylated; binds to 5.8 S rRNA; homologous to mammalian
                     ribosomal protein L36, no bacterial homolog; RPL36A has a
                     paralog, RPL36B, that arose from the whole genome
                     duplication"
                     /codon_start=1
                     /product="60S ribosomal protein eL36 RPL36A"
                     /protein_id="NP_013920.1"
                     /db_xref="GeneID:855232"
                     /db_xref="SGD:S000004807"
                     /translation="

MTVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH"

     misc_feature    10..297
                     /gene="RPL36A"
                     /locus_tag="YMR194W"
                     /gene_synonym="RPL39B"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      

atgaccgttaagacaggaattgctattggtttaaacaaaggtaagaaggtcactagcatgaccccagctccaaaaatctcttacaagaaaggtgctgcttccaacagaaccaagttcgtaagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgattgatctaataagaaactctggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcttctcgtcgtcactaa

//