GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-23 03:28:42, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       NM_001182701             303 bp    mRNA    linear   PLN 04-APR-2018
DEFINITION  Saccharomyces cerevisiae S288C ribosomal 60S subunit protein L36A
            (RPL36A), partial mRNA.
ACCESSION   NM_001182701
VERSION     NM_001182701.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Bowman,S., Churcher,C., Badcock,K., Brown,D., Chillingworth,T.,
            Connor,R., Dedman,K., Devlin,K., Gentles,S., Hamlin,N., Hunt,S.,
            Jagels,K., Lye,G., Moule,S., Odell,C., Pearson,D., Rajandream,M.,
            Rice,P., Skelton,J., Walsh,S., Whitehead,S. and Barrell,B.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII
  JOURNAL   Nature 387 (6632 SUPPL), 90-93 (1997)
   PUBMED   9169872
REFERENCE   2  (bases 1 to 303)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   3  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2018) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 303)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   5  (bases 1 to 303)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   6  (bases 1 to 303)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001145).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-2-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="XIII"
     gene            <1..>303
                     /gene="RPL36A"
                     /locus_tag="YMR194W"
                     /gene_synonym="RPL39B"
                     /db_xref="GeneID:855232"
     CDS             1..303
                     /gene="RPL36A"
                     /locus_tag="YMR194W"
                     /gene_synonym="RPL39B"
                     /note="Ribosomal 60S subunit protein L36A; N-terminally
                     acetylated; binds to 5.8 S rRNA; homologous to mammalian
                     ribosomal protein L36, no bacterial homolog; RPL36A has a
                     paralog, RPL36B, that arose from the whole genome
                     duplication"
                     /codon_start=1
                     /product="ribosomal 60S subunit protein L36A"
                     /protein_id="NP_013920.1"
                     /db_xref="GeneID:855232"
                     /db_xref="SGD:S000004807"
                     /translation="
MTVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH"
     misc_feature    10..297
                     /gene="RPL36A"
                     /locus_tag="YMR194W"
                     /gene_synonym="RPL39B"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:307352"
ORIGIN      
atgaccgttaagacaggaattgctattggtttaaacaaaggtaagaaggtcactagcatgaccccagctccaaaaatctcttacaagaaaggtgctgcttccaacagaaccaagttcgtaagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgattgatctaataagaaactctggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcttctcgtcgtcactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]