ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-03-05 16:52:05, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001182701 303 bp mRNA linear PLN 23-JAN-2026
DEFINITION Saccharomyces cerevisiae S288C 60S ribosomal protein eL36 RPL36A
(RPL36A), partial mRNA.
ACCESSION NM_001182701
VERSION NM_001182701.1
DBLINK BioProject: PRJNA128
KEYWORDS RefSeq.
SOURCE Saccharomyces cerevisiae S288C
ORGANISM Saccharomyces cerevisiae S288C
Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
Saccharomyces.
REFERENCE 1 (bases 1 to 303)
AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
Weng,S. and Cherry,J.M.
TITLE New data and collaborations at the Saccharomyces Genome Database:
updated reference genome, alleles, and the Alliance of Genome
Resources
JOURNAL Genetics 220 (4) (2022)
PUBMED 34897464
REFERENCE 2 (bases 1 to 303)
AUTHORS Bowman,S., Churcher,C., Badcock,K., Brown,D., Chillingworth,T.,
Connor,R., Dedman,K., Devlin,K., Gentles,S., Hamlin,N., Hunt,S.,
Jagels,K., Lye,G., Moule,S., Odell,C., Pearson,D., Rajandream,M.,
Rice,P., Skelton,J., Walsh,S., Whitehead,S. and Barrell,B.
TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII
JOURNAL Nature 387 (6632 SUPPL), 90-93 (1997)
PUBMED 9169872
REFERENCE 3 (bases 1 to 303)
AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
Oliver,S.G.
TITLE Life with 6000 genes
JOURNAL Science 274 (5287), 546 (1996)
PUBMED 8849441
REFERENCE 4 (bases 1 to 303)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (23-JAN-2026) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 5 (bases 1 to 303)
CONSRTM Saccharomyces Genome Database
TITLE Direct Submission
JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford
University, Stanford, CA 94305-5120, USA
REMARK Protein update by submitter
REFERENCE 6 (bases 1 to 303)
CONSRTM Saccharomyces Genome Database
TITLE Direct Submission
JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford
University, Stanford, CA 94305-5120, USA
REMARK Sequence update by submitter
REFERENCE 7 (bases 1 to 303)
CONSRTM Saccharomyces Genome Database
TITLE Direct Submission
JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford
University, Stanford, CA 94305-5120, USA
COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record
is derived from an annotated genomic sequence (NC_001145).
##Genome-Annotation-Data-START##
Annotation Provider :: SGD
Annotation Status :: Full Annotation
Annotation Version :: R64-4-1
URL :: http://www.yeastgenome.org/
##Genome-Annotation-Data-END##
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..303
/organism="Saccharomyces cerevisiae S288C"
/mol_type="mRNA"
/strain="S288C"
/db_xref="taxon:559292"
/chromosome="XIII"
gene <1..>303
/gene="RPL36A"
/locus_tag="YMR194W"
/gene_synonym="RPL39B"
/db_xref="GeneID:855232"
CDS 1..303
/gene="RPL36A"
/locus_tag="YMR194W"
/gene_synonym="RPL39B"
/experiment="EXISTENCE:direct assay:GO:0002181 cytoplasmic
translation [PMID:18782943]"
/experiment="EXISTENCE:direct assay:GO:0003723 RNA binding
[PMID:6337137]"
/experiment="EXISTENCE:direct assay:GO:0003735 structural
constituent of ribosome [PMID:18782943]"
/experiment="EXISTENCE:direct assay:GO:0022625 cytosolic
large ribosomal subunit [PMID:18782943]"
/experiment="EXISTENCE:mutant phenotype:GO:0000470
maturation of LSU-rRNA [PMID:37865285]"
/experiment="EXISTENCE:mutant phenotype:GO:0180023
cytosolic large ribosomal subunit assembly
[PMID:37865285]"
/note="Ribosomal 60S subunit protein L36A; N-terminally
acetylated; binds to 5.8 S rRNA; homologous to mammalian
ribosomal protein L36, no bacterial homolog; RPL36A has a
paralog, RPL36B, that arose from the whole genome
duplication"
/codon_start=1
/product="60S ribosomal protein eL36 RPL36A"
/protein_id="NP_013920.1"
/db_xref="GeneID:855232"
/db_xref="SGD:S000004807"
/translation="
MTVKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH"
misc_feature 10..297
/gene="RPL36A"
/locus_tag="YMR194W"
/gene_synonym="RPL39B"
/note="Ribosomal protein L36e; Region: Ribosomal_L36e;
pfam01158"
/db_xref="CDD:460088"
ORIGIN
atgaccgttaagacaggaattgctattggtttaaacaaaggtaagaaggtcactagcatgaccccagctccaaaaatctcttacaagaaaggtgctgcttccaacagaaccaagttcgtaagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgattgatctaataagaaactctggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcttctcgtcgtcactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]