LOCUS       NM_001182635             714 bp    mRNA    linear   PLN 17-DEC-2024
DEFINITION  Saccharomyces cerevisiae S288C Erg29p (ERG29), partial mRNA.
ACCESSION   NM_001182635
VERSION     NM_001182635.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 714)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 714)
  AUTHORS   Bowman,S., Churcher,C., Badcock,K., Brown,D., Chillingworth,T.,
            Connor,R., Dedman,K., Devlin,K., Gentles,S., Hamlin,N., Hunt,S.,
            Jagels,K., Lye,G., Moule,S., Odell,C., Pearson,D., Rajandream,M.,
            Rice,P., Skelton,J., Walsh,S., Whitehead,S. and Barrell,B.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII
  JOURNAL   Nature 387 (6632 SUPPL), 90-93 (1997)
   PUBMED   9169872
REFERENCE   3  (bases 1 to 714)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 714)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 714)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 714)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 714)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001145).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..714
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="XIII"
     gene            <1..>714
                     /gene="ERG29"
                     /locus_tag="YMR134W"
                     /db_xref="GeneID:855164"
     CDS             1..714
                     /gene="ERG29"
                     /locus_tag="YMR134W"
                     /experiment="EXISTENCE:direct assay:GO:0005635 nuclear
                     envelope [PMID:14690591]"
                     /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
                     [PMID:11914276]"
                     /experiment="EXISTENCE:direct assay:GO:0005783 endoplasmic
                     reticulum [PMID:14690591|PMID:14562095|PMID:26928762]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006696
                     ergosterol biosynthetic process
                     [PMID:29773647|PMID:23892078]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006879
                     intracellular iron ion homeostasis [PMID:9180083]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0007005
                     mitochondrion organization [PMID:16135527]"
                     /note="hypothetical protein involved in ergosterol
                     biosynthesis; conditional mutants produce less ergosterol,
                     display impaired oxygen consumption, respiratory growth,
                     mitochondrial iron utilization, and are more sensitive to
                     oxidative stress; mutant bm-8 has a growth defect on
                     iron-limited medium that is complemented by overexpression
                     of Yfh1p; protein localizes to the cytoplasm, ER and
                     nuclear envelope; highly conserved in ascomycetes"
                     /codon_start=1
                     /product="Erg29p"
                     /protein_id="NP_013853.1"
                     /db_xref="GeneID:855164"
                     /db_xref="SGD:S000004741"
                     /translation="

MSLKDRYLNLELKLINKLQELPYVHQFIHDRISGRITLFLIVVGTLAFFNELYITIEMSLLQKNTSEELERGRIDESLKLHRMLVSDEYHGKEYKDEKSGIVIEEFEDRDKFFAKPVFVSELDVECNVIVDGKELLSTPLKFHVEFSPEDYENEKRPEFGTTLRVLRLRLYHYFKDCEIYRDIIKNEGGEGARKFTISNGVKIYNHKDELLPLNIDDVQLCFLKIDTGNTIKCEFIL"

ORIGIN      

atgtcgttaaaggataggtatctaaatctcgaattaaaattaataaataaactacaggagttgccatatgttcatcaatttatccatgatcgaataagtggtaggataactctctttttgatagtggttggtacgcttgcattttttaacgaactgtatataacgatcgaaatgagtcttctacaaaagaacacatcagaagaactagagcgtggaagaatcgatgaaagtctgaagcttcatcggatgttggtgagtgatgaatatcacggtaaagaatacaaagacgagaaaagcggtattgttattgaagagttcgaagatcgcgataagttttttgcaaaacctgtgtttgtatcagaattggatgtcgaatgtaatgttattgtagatgggaaagaacttctgtccaccccattaaaatttcatgttgaattttctccagaggattatgaaaatgaaaaaagacctgagtttggtactaccttgcgtgtattgaggctgagactttaccactactttaaagattgcgaaatatatcgcgatataattaagaatgagggcggtgaaggggcaagaaagtttacgatttccaacggtgtcaaaatttacaatcataaagatgaactactgccattgaatatcgatgatgttcaattatgtttcctgaagattgatacgggaaacacgataaaatgcgaattcatactatga

//