LOCUS       NM_001182437             549 bp    mRNA    linear   PLN 15-SEP-2023
DEFINITION  Saccharomyces cerevisiae S288C peptidylprolyl isomerase CPR3
            (CPR3), partial mRNA.
ACCESSION   NM_001182437
VERSION     NM_001182437.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 549)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 549)
  AUTHORS   Bowman,S., Churcher,C., Badcock,K., Brown,D., Chillingworth,T.,
            Connor,R., Dedman,K., Devlin,K., Gentles,S., Hamlin,N., Hunt,S.,
            Jagels,K., Lye,G., Moule,S., Odell,C., Pearson,D., Rajandream,M.,
            Rice,P., Skelton,J., Walsh,S., Whitehead,S. and Barrell,B.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII
  JOURNAL   Nature 387 (6632 SUPPL), 90-93 (1997)
   PUBMED   9169872
REFERENCE   3  (bases 1 to 549)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 549)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-SEP-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 549)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 549)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 549)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001145).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..549
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="XIII"
     gene            <1..>549
                     /gene="CPR3"
                     /locus_tag="YML078W"
                     /gene_synonym="CYP3"
                     /db_xref="GeneID:854897"
     CDS             1..549
                     /gene="CPR3"
                     /locus_tag="YML078W"
                     /gene_synonym="CYP3"
                     /EC_number="5.2.1.8"
                     /experiment="EXISTENCE:direct assay:GO:0003755
                     peptidyl-prolyl cis-trans isomerase activity
                     [PMID:7603990]"
                     /experiment="EXISTENCE:direct assay:GO:0005739
                     mitochondrion
                     [PMID:14576278|PMID:16823961|PMID:24769239|PMID:7603990]"
                     /experiment="EXISTENCE:direct assay:GO:0006457 protein
                     folding [PMID:7603990]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006915
                     apoptotic process [PMID:17881727]"
                     /note="Mitochondrial peptidyl-prolyl cis-trans isomerase
                     (cyclophilin); catalyzes the cis-trans isomerization of
                     peptide bonds N-terminal to proline residues; involved in
                     protein refolding after import into mitochondria"
                     /codon_start=1
                     /product="peptidylprolyl isomerase CPR3"
                     /protein_id="NP_013633.1"
                     /db_xref="GeneID:854897"
                     /db_xref="SGD:S000004543"
                     /translation="

MFKRSIIQQSRLFSNSASRLGKKVFFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKAIESYGTASGKPRAEIVIEEAGEL"

     misc_feature    67..540
                     /gene="CPR3"
                     /locus_tag="YML078W"
                     /gene_synonym="CYP3"
                     /note="Cyclophilin A, B and H-like cyclophilin-type
                     peptidylprolyl cis- trans isomerase (PPIase) domain. This
                     family represents the archetypal cystolic cyclophilin
                     similar to human cyclophilins A, B and H. PPIase is an
                     enzyme which accelerates protein folding...; Region:
                     cyclophilin_ABH_like; cd01926"
                     /db_xref="CDD:238907"
     misc_feature    order(214..219,232..234,385..387,391..393,415..417)
                     /gene="CPR3"
                     /locus_tag="YML078W"
                     /gene_synonym="CYP3"
                     /note="active site"
                     /db_xref="CDD:238907"
ORIGIN      

atgtttaaacgttccatcattcaacagtcccgcttattctccaattctgcttctagactaggtaaaaaagtgttctttgatcctgcggtcaatggaaccaaaatcggcagaatagaatttgaattatatgataatgtggttcctaaaactgctgaaaatttcagagccttatgtaccggcgaaaagggctggggctataaaggtgtccctttccacagaatcatcccagacttcatgatccaaggtggtgacactgatttgactaacggttttgggggcaaatccatttacggttccaagttcgctgacgaaaattttgtcaaaaagcatgacaaggcaggtttgttatctatggcaaatgctggaccaaacactaacggttctcaattcttcattaccactgtgccttgtccatggttggatggaaaacacgttgtctttggtgaggtaaccaaaggtatggacattgtcaaagcaatcgaatcatacggtactgcttctggtaaaccaagagctgaaatcgttatcgaagaagctggtgagttatga

//