2024-05-05 18:17:49, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001182437 549 bp mRNA linear PLN 15-SEP-2023 DEFINITION Saccharomyces cerevisiae S288C peptidylprolyl isomerase CPR3 (CPR3), partial mRNA. ACCESSION NM_001182437 VERSION NM_001182437.1 DBLINK BioProject: PRJNA128 KEYWORDS RefSeq. SOURCE Saccharomyces cerevisiae S288C ORGANISM Saccharomyces cerevisiae S288C Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 549) AUTHORS Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M., Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S., Weng,S. and Cherry,J.M. TITLE New data and collaborations at the Saccharomyces Genome Database: updated reference genome, alleles, and the Alliance of Genome Resources JOURNAL Genetics 220 (4) (2022) PUBMED 34897464 REFERENCE 2 (bases 1 to 549) AUTHORS Bowman,S., Churcher,C., Badcock,K., Brown,D., Chillingworth,T., Connor,R., Dedman,K., Devlin,K., Gentles,S., Hamlin,N., Hunt,S., Jagels,K., Lye,G., Moule,S., Odell,C., Pearson,D., Rajandream,M., Rice,P., Skelton,J., Walsh,S., Whitehead,S. and Barrell,B. TITLE The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII JOURNAL Nature 387 (6632 SUPPL), 90-93 (1997) PUBMED 9169872 REFERENCE 3 (bases 1 to 549) AUTHORS Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B., Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M., Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and Oliver,S.G. TITLE Life with 6000 genes JOURNAL Science 274 (5287), 546 (1996) PUBMED 8849441 REFERENCE 4 (bases 1 to 549) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (14-SEP-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 5 (bases 1 to 549) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (04-MAY-2012) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Protein update by submitter REFERENCE 6 (bases 1 to 549) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (31-MAR-2011) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA REMARK Sequence update by submitter REFERENCE 7 (bases 1 to 549) CONSRTM Saccharomyces Genome Database TITLE Direct Submission JOURNAL Submitted (14-DEC-2009) Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA COMMENT REVIEWED REFSEQ: This record has been curated by SGD. This record is derived from an annotated genomic sequence (NC_001145). ##Genome-Annotation-Data-START## Annotation Provider :: SGD Annotation Status :: Full Annotation Annotation Version :: R64-4-1 URL :: http://www.yeastgenome.org/ ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..549 /organism="Saccharomyces cerevisiae S288C" /mol_type="mRNA" /strain="S288C" /db_xref="taxon:559292" /chromosome="XIII" gene <1..>549 /gene="CPR3" /locus_tag="YML078W" /gene_synonym="CYP3" /db_xref="GeneID:854897" CDS 1..549 /gene="CPR3" /locus_tag="YML078W" /gene_synonym="CYP3" /EC_number="5.2.1.8" /experiment="EXISTENCE:direct assay:GO:0003755 peptidyl-prolyl cis-trans isomerase activity [PMID:7603990]" /experiment="EXISTENCE:direct assay:GO:0005739 mitochondrion [PMID:14576278|PMID:16823961|PMID:24769239|PMID:7603990]" /experiment="EXISTENCE:direct assay:GO:0006457 protein folding [PMID:7603990]" /experiment="EXISTENCE:mutant phenotype:GO:0006915 apoptotic process [PMID:17881727]" /note="Mitochondrial peptidyl-prolyl cis-trans isomerase (cyclophilin); catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; involved in protein refolding after import into mitochondria" /codon_start=1 /product="peptidylprolyl isomerase CPR3" /protein_id="NP_013633.1" /db_xref="GeneID:854897" /db_xref="SGD:S000004543" /translation="
MFKRSIIQQSRLFSNSASRLGKKVFFDPAVNGTKIGRIEFELYDNVVPKTAENFRALCTGEKGWGYKGVPFHRIIPDFMIQGGDTDLTNGFGGKSIYGSKFADENFVKKHDKAGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKAIESYGTASGKPRAEIVIEEAGEL"
misc_feature 67..540 /gene="CPR3" /locus_tag="YML078W" /gene_synonym="CYP3" /note="Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain. This family represents the archetypal cystolic cyclophilin similar to human cyclophilins A, B and H. PPIase is an enzyme which accelerates protein folding...; Region: cyclophilin_ABH_like; cd01926" /db_xref="CDD:238907" misc_feature order(214..219,232..234,385..387,391..393,415..417) /gene="CPR3" /locus_tag="YML078W" /gene_synonym="CYP3" /note="active site" /db_xref="CDD:238907" ORIGIN
atgtttaaacgttccatcattcaacagtcccgcttattctccaattctgcttctagactaggtaaaaaagtgttctttgatcctgcggtcaatggaaccaaaatcggcagaatagaatttgaattatatgataatgtggttcctaaaactgctgaaaatttcagagccttatgtaccggcgaaaagggctggggctataaaggtgtccctttccacagaatcatcccagacttcatgatccaaggtggtgacactgatttgactaacggttttgggggcaaatccatttacggttccaagttcgctgacgaaaattttgtcaaaaagcatgacaaggcaggtttgttatctatggcaaatgctggaccaaacactaacggttctcaattcttcattaccactgtgccttgtccatggttggatggaaaacacgttgtctttggtgaggtaaccaaaggtatggacattgtcaaagcaatcgaatcatacggtactgcttctggtaaaccaagagctgaaatcgttatcgaagaagctggtgagttatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]