LOCUS       NM_001181898             576 bp    mRNA    linear   PLN 15-SEP-2023
DEFINITION  Saccharomyces cerevisiae S288C flavin-dependent quinone reductase
            (LOT6), partial mRNA.
ACCESSION   NM_001181898
VERSION     NM_001181898.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 576)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 576)
  AUTHORS   Johnston,M., Hillier,L., Riles,L., Albermann,K., Andre,B.,
            Ansorge,W., Benes,V., Bruckner,M., Delius,H., Dubois,E.,
            Dusterhoft,A., Entian,K.D., Floeth,M., Goffeau,A., Hebling,U.,
            Heumann,K., Heuss-Neitzel,D., Hilbert,H., Hilger,F., Kleine,K.,
            Kotter,P., Louis,E.J., Messenguy,F., Mewes,H.W., Hoheisel,J.D. et
            al.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome XII
  JOURNAL   Nature 387 (6632 SUPPL), 87-90 (1997)
   PUBMED   9169871
REFERENCE   3  (bases 1 to 576)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 576)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (14-SEP-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 576)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2015) Department of Genetics, Stanford
            University, Stanford, CA, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 576)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2013) Department of Genetics, Stanford
            University, Stanford, CA, USA
  REMARK    Protein update by submitter
REFERENCE   7  (bases 1 to 576)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA, USA
  REMARK    Protein update by submitter
REFERENCE   8  (bases 1 to 576)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA, USA
  REMARK    Sequence update by submitter
REFERENCE   9  (bases 1 to 576)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001144).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..576
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="XII"
     gene            <1..>576
                     /gene="LOT6"
                     /locus_tag="YLR011W"
                     /db_xref="GeneID:850698"
     CDS             1..576
                     /gene="LOT6"
                     /locus_tag="YLR011W"
                     /EC_number="1.5.1.39"
                     /experiment="EXISTENCE:direct assay:GO:0003955 NAD(P)H
                     dehydrogenase (quinone) activity [PMID:17298444]"
                     /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
                     [PMID:14562095|PMID:17298444]"
                     /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
                     [PMID:14562095]"
                     /experiment="EXISTENCE:direct assay:GO:0005829 cytosol
                     [PMID:17298444]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0003955 NAD(P)H
                     dehydrogenase (quinone) activity [PMID:17298444]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006915
                     apoptotic process [PMID:19709309]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0034599
                     cellular response to oxidative stress [PMID:17298444]"
                     /note="FMN-dependent NAD(P)H:quinone reductase; role in
                     apoptosis-like cell death; may be involved in quinone
                     detoxification; expression elevated at low temperature;
                     sequesters the Cin5p transcription factor in the cytoplasm
                     in complex with the proteasome under reducing conditions"
                     /codon_start=1
                     /product="flavin-dependent quinone reductase"
                     /protein_id="NP_013111.1"
                     /db_xref="GeneID:850698"
                     /db_xref="SGD:S000004001"
                     /translation="

MKVGIIMGSVRAKRVCPEIAAYVKRTIENSEELIDQKLKIQVVDLQQIALPLYEDDDELIPAQIKSVDEYADSKTRSWSRIVNALDIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGHGGSKCNDQLQEVLHGLKMNVIGGVAVKIPVGTIPLPEDIVPQLSVHNEEILQLLASCIETTRNK"

     misc_feature    1..567
                     /gene="LOT6"
                     /locus_tag="YLR011W"
                     /note="NAD(P)H-dependent FMN reductase [Energy production
                     and conversion]; Region: SsuE; COG0431"
                     /db_xref="CDD:223508"
ORIGIN      

atgaaagtgggtattataatgggttctgtgagggcaaagagggtatgcccagaaattgcagcatacgtaaaacgtacaattgaaaatagcgaagaattaatagaccagaagctgaaaatacaagtagtagatttacaacagattgctcttcccttatatgaagatgatgacgaactgatccctgcgcaaataaagagcgtggatgagtatgcagacagcaaaactcgatcgtggagtcgcatcgtaaatgcattagatattattgtattcgttacacctcaatataattgggggtatccagcagccttaaaaaatgcaattgatcgtctttaccatgaatggcacggaaaacctgccctggtggtaagctacggcggtcatggcggtagtaagtgtaatgaccaacttcaagaggtactacatggtttgaagatgaatgttataggtggagtggcggtgaaaataccggtaggtacgataccgttacccgaggacattgtaccacaactcagcgtgcacaatgaagagatcctgcaattactcgcatcgtgcatcgaaacaacgaggaataaataa

//