LOCUS       NM_001181247             438 bp    mRNA    linear   PLN 30-JUN-2025
DEFINITION  Saccharomyces cerevisiae S288C 40S ribosomal protein uS12 RPS23A
            (RPS23A), partial mRNA.
ACCESSION   NM_001181247
VERSION     NM_001181247.3
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 438)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 438)
  AUTHORS   Tettelin,H., Agostoni Carbone,M.L., Albermann,K., Albers,M.,
            Arroyo,J., Backes,U., Barreiros,T., Bertani,I., Bjourson,A.J.,
            Bruckner,M., Bruschi,C.V., Carignani,G., Castagnoli,L., Cerdan,E.,
            Clemente,M.L., Coblenz,A., Coglievina,M., Coissac,E., Defoor,E.,
            Del Bino,S., Delius,H., Delneri,D., de Wergifosse,P., Dujon,B.,
            Kleine,K. et al.
  TITLE     The nucleotide sequence of Saccharomyces cerevisiae chromosome VII
  JOURNAL   Nature 387 (6632 SUPPL), 81-84 (1997)
   PUBMED   9169869
REFERENCE   3  (bases 1 to 438)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   4  (bases 1 to 438)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUN-2025) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 438)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (16-JAN-2015) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 438)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   7  (bases 1 to 438)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   8  (bases 1 to 438)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001139).
            
            On Jul 30, 2012 this sequence version replaced NM_001181247.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..438
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="VII"
     gene            <1..>438
                     /gene="RPS23A"
                     /locus_tag="YGR118W"
                     /db_xref="GeneID:853015"
     CDS             1..438
                     /gene="RPS23A"
                     /locus_tag="YGR118W"
                     /experiment="EXISTENCE:direct assay:GO:0003735 structural
                     constituent of ribosome [PMID:6814480]"
                     /experiment="EXISTENCE:direct assay:GO:0022627 cytosolic
                     small ribosomal subunit [PMID:6814480]"
                     /experiment="EXISTENCE:genetic interaction:GO:0000462
                     maturation of SSU-rRNA from tricistronic rRNA transcript
                     (SSU-rRNA, 5.8S rRNA, LSU-rRNA) [PMID:16246728]"
                     /experiment="EXISTENCE:genetic interaction:GO:0006450
                     regulation of translational fidelity
                     [PMID:7498767|PMID:8415737|PMID:8950190]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006450
                     regulation of translational fidelity
                     [PMID:8415737|PMID:7498767|PMID:8950190]"
                     /note="Ribosomal protein 28 (rp28) of the small (40S)
                     ribosomal subunit; required for translational accuracy;
                     homologous to mammalian ribosomal protein S23 and
                     bacterial S12; RPS23A has a paralog, RPS23B, that arose
                     from the whole genome duplication; deletion of both RPS23A
                     and RPS23B is lethal"
                     /codon_start=1
                     /product="40S ribosomal protein uS12 RPS23A"
                     /protein_id="NP_011633.3"
                     /db_xref="GeneID:853015"
                     /db_xref="SGD:S000003350"
                     /translation="

MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFGGSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEVLLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"

     misc_feature    10..435
                     /gene="RPS23A"
                     /locus_tag="YGR118W"
                     /note="40S ribosomal S23; Provisional; Region: PTZ00067"
                     /db_xref="CDD:185422"
     misc_feature    order(82..84,88..102,106..108,112..129,133..153,184..210,
                     226..234,256..258,262..273,310..330,337..348,364..369,
                     382..384,388..390,418..426)
                     /gene="RPS23A"
                     /locus_tag="YGR118W"
                     /note="18S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239465"
     misc_feature    order(184..189,340..342)
                     /gene="RPS23A"
                     /locus_tag="YGR118W"
                     /note="streptomycin interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:239465"
     misc_feature    187..192
                     /gene="RPS23A"
                     /locus_tag="YGR118W"
                     /note="28S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239465"
     misc_feature    order(190..207,268..294)
                     /gene="RPS23A"
                     /locus_tag="YGR118W"
                     /note="aminoacyl-tRNA interaction site (A-site)
                     [nucleotide binding]; other site"
                     /db_xref="CDD:239465"
     misc_feature    295..297
                     /gene="RPS23A"
                     /locus_tag="YGR118W"
                     /note="eEF2 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239465"
ORIGIN      

atgggtaaaggtaagccaagaggtttgaactctgctagaaagctacgtgtccacagaagaaacaaccgttgggccgaaaacaactacaagaagagattgttgggtactgccttcaagtcttctccattcggtggttcttctcatgccaagggtatcgtcttggaaaaattgggtatcgaatccaagcaacctaactctgctatcagaaagtgtgttagagttcaattaatcaagaacggtaagaaggtcactgctttcgttccaaacgatggttgtttgaactttgtcgacgaaaatgatgaagtcttgctagcaggtttcggtagaaagggtaaagctaagggtgatattccaggtgttagattcaaggtcgttaaggtctctggtgtctccttgttggctttgtggaaagaaaagaaggaaaagccaagatcataa

//