GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-15 15:29:34, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001179310            1203 bp    mRNA    linear   PLN 17-DEC-2024
DEFINITION  Saccharomyces cerevisiae S288C NADPH dehydrogenase (OYE2), partial
            mRNA.
ACCESSION   NM_001179310
VERSION     NM_001179310.1
DBLINK      BioProject: PRJNA128
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae S288C
  ORGANISM  Saccharomyces cerevisiae S288C
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 1203)
  AUTHORS   Engel,S.R., Wong,E.D., Nash,R.S., Aleksander,S., Alexander,M.,
            Douglass,E., Karra,K., Miyasato,S.R., Simison,M., Skrzypek,M.S.,
            Weng,S. and Cherry,J.M.
  TITLE     New data and collaborations at the Saccharomyces Genome Database:
            updated reference genome, alleles, and the Alliance of Genome
            Resources
  JOURNAL   Genetics 220 (4) (2022)
   PUBMED   34897464
REFERENCE   2  (bases 1 to 1203)
  AUTHORS   Goffeau,A., Barrell,B.G., Bussey,H., Davis,R.W., Dujon,B.,
            Feldmann,H., Galibert,F., Hoheisel,J.D., Jacq,C., Johnston,M.,
            Louis,E.J., Mewes,H.W., Murakami,Y., Philippsen,P., Tettelin,H. and
            Oliver,S.G.
  TITLE     Life with 6000 genes
  JOURNAL   Science 274 (5287), 546 (1996)
   PUBMED   8849441
REFERENCE   3  (bases 1 to 1203)
  AUTHORS   Johnston,M., Andrews,S., Brinkman,R., Cooper,J., Ding,H., Dover,J.,
            Du,Z., Favello,A., Fulton,L., Gattung,S. et al.
  TITLE     Complete nucleotide sequence of Saccharomyces cerevisiae chromosome
            VIII
  JOURNAL   Science 265 (5181), 2077-2082 (1994)
   PUBMED   8091229
REFERENCE   4  (bases 1 to 1203)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-DEC-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   5  (bases 1 to 1203)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (04-MAY-2012) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Protein update by submitter
REFERENCE   6  (bases 1 to 1203)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
  REMARK    Sequence update by submitter
REFERENCE   7  (bases 1 to 1203)
  CONSRTM   Saccharomyces Genome Database
  TITLE     Direct Submission
  JOURNAL   Submitted (11-DEC-2009) Department of Genetics, Stanford
            University, Stanford, CA 94305-5120, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by SGD. This record
            is derived from an annotated genomic sequence (NC_001140).
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: SGD
            Annotation Status   :: Full Annotation
            Annotation Version  :: R64-4-1
            URL                 :: http://www.yeastgenome.org/
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1203
                     /organism="Saccharomyces cerevisiae S288C"
                     /mol_type="mRNA"
                     /strain="S288C"
                     /db_xref="taxon:559292"
                     /chromosome="VIII"
     gene            <1..>1203
                     /gene="OYE2"
                     /locus_tag="YHR179W"
                     /db_xref="GeneID:856584"
     CDS             1..1203
                     /gene="OYE2"
                     /locus_tag="YHR179W"
                     /EC_number="1.6.99.1"
                     /experiment="EXISTENCE:direct assay:GO:0003959 NADPH
                     dehydrogenase activity [PMID:8454584]"
                     /experiment="EXISTENCE:direct assay:GO:0005634 nucleus
                     [PMID:14562095]"
                     /experiment="EXISTENCE:direct assay:GO:0005737 cytoplasm
                     [PMID:14562095]"
                     /experiment="EXISTENCE:direct assay:GO:0005739
                     mitochondrion [PMID:14576278|PMID:16823961]"
                     /experiment="EXISTENCE:mutant phenotype:GO:0006915
                     apoptotic process [PMID:17897954]"
                     /note="Conserved NADPH oxidoreductase containing flavin
                     mononucleotide (FMN); responsible for geraniol reduction
                     into citronellol during fermentation; homologous to Oye3p
                     with different ligand binding and catalytic properties;
                     may be involved in sterol metabolism, oxidative stress
                     response, and programmed cell death; protein abundance
                     increases in response to DNA replication stress"
                     /codon_start=1
                     /product="NADPH dehydrogenase"
                     /protein_id="NP_012049.1"
                     /db_xref="GeneID:856584"
                     /db_xref="SGD:S000001222"
                     /translation="
MPFVKDFKPQALGDTNLFKPIKIGNNELLHRAVIPPLTRMRAQHPGNIPNRDWAVEYYAQRAQRPGTLIITEGTFPSPQSGGYDNAPGIWSEEQIKEWTKIFKAIHENKSFAWVQLWVLGWAAFPDTLARDGLRYDSASDNVYMNAEQEEKAKKANNPQHSITKDEIKQYVKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNNRTDEYGGSIENRARFTLEVVDAVVDAIGPEKVGLRLSPYGVFNSMSGGAETGIVAQYAYVLGELERRAKAGKRLAFVHLVEPRVTNPFLTEGEGEYNGGSNKFAYSIWKGPIIRAGNFALHPEVVREEVKDPRTLIGYGRFFISNPDLVDRLEKGLPLNKYDRDTFYKMSAEGYIDYPTYEEALKLGWDKN"
     misc_feature    46..1116
                     /gene="OYE2"
                     /locus_tag="YHR179W"
                     /note="Old yellow enzyme (OYE)-like FMN binding domain.
                     OYE was the first flavin-dependent enzyme identified,
                     however its true physiological role remains elusive to
                     this day. Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a...; Region:
                     OYE_like_FMN; cd02933"
                     /db_xref="CDD:239243"
     misc_feature    order(106..108,112..114,217..219,343..345,730..732,
                     973..975,1036..1038,1042..1050)
                     /gene="OYE2"
                     /locus_tag="YHR179W"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239243"
     misc_feature    order(106..108,112..114,217..219,343..345,349..351,
                     370..372,574..576,583..585,589..591,730..732,751..753,
                     973..975,1036..1038,1042..1047)
                     /gene="OYE2"
                     /locus_tag="YHR179W"
                     /note="active site"
                     /db_xref="CDD:239243"
     misc_feature    order(112..114,349..351,574..576,583..585,589..591,
                     1045..1047)
                     /gene="OYE2"
                     /locus_tag="YHR179W"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239243"
     misc_feature    589..591
                     /gene="OYE2"
                     /locus_tag="YHR179W"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:239243"
ORIGIN      
atgccatttgttaaggactttaagccacaagctttgggtgacaccaacttattcaaaccaatcaaaattggtaacaatgaacttctacaccgtgctgtcattcctccattgactagaatgagagcccaacatccaggtaatattccaaacagagactgggccgttgaatactacgctcaacgtgctcaaagaccaggaaccttgattatcactgaaggtacctttccctctccacaatctgggggttacgacaatgctccaggtatctggtccgaagaacaaattaaagaatggaccaagattttcaaggctattcatgagaataaatcgttcgcatgggtccaattatgggttctaggttgggctgctttcccagacacccttgctagggatggtttgcgttacgactccgcttctgacaacgtgtatatgaatgcagaacaagaagaaaaggctaagaaggctaacaacccacaacacagtataacaaaggatgaaattaagcaatacgtcaaagaatacgtccaagctgccaaaaactccattgctgctggtgccgatggtgttgaaatccacagcgctaacggttacttgttgaaccagttcttggacccacactccaataacagaaccgatgagtatggtggatccatcgaaaacagagcccgtttcaccttggaagtggttgatgcagttgtcgatgctattggccctgaaaaagtcggtttgagattgtctccatatggtgtcttcaacagtatgtctggtggtgctgaaaccggtattgttgctcaatatgcttatgtcttaggtgaactagaaagaagagctaaagctggcaagcgtttggctttcgtccatctagttgaacctcgtgtcaccaacccatttttaactgaaggtgaaggtgaatacaatggaggtagcaacaaatttgcttattctatctggaagggcccaattattagagctggtaactttgctctgcacccagaagttgtcagagaagaggtgaaggatcctagaacattgatcggttacggtagattttttatctctaatccagatttggttgatcgtttggaaaaagggttaccattaaacaaatatgacagagacactttctacaaaatgtcagctgagggatacattgactaccctacgtacgaagaagctctaaaactcggttgggacaaaaattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]