LOCUS       NM_001173442             936 bp    mRNA    linear   MAM 14-NOV-2021
DEFINITION  Felis catus Nanog homeobox (NANOG), mRNA.
ACCESSION   NM_001173442
VERSION     NM_001173442.1
KEYWORDS    RefSeq.
SOURCE      Felis catus (domestic cat)
  ORGANISM  Felis catus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Carnivora; Feliformia; Felidae;
            Felinae; Felis.
REFERENCE   1  (bases 1 to 936)
  AUTHORS   Yu XF, Kim JH, Jung EJ, Jeon JT and Kong IK.
  TITLE     Cloning and characterization of cat POU5F1 and NANOG for
            identification of embryonic stem-like cells
  JOURNAL   J. Reprod. Dev. 55 (4), 361-366 (2009)
   PUBMED   19293558
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FJ775540.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FJ775540.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..936
                     /organism="Felis catus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9685"
                     /chromosome="B4"
                     /map="B4"
     gene            1..936
                     /gene="NANOG"
                     /note="Nanog homeobox"
                     /db_xref="GeneID:100174790"
     CDS             1..936
                     /gene="NANOG"
                     /codon_start=1
                     /product="homeobox protein NANOG"
                     /protein_id="NP_001166913.1"
                     /db_xref="GeneID:100174790"
                     /translation="

MNTDPAQPQCPPCPEAPDSRDSSPVPEIDGPEENYAPLRMSSAETPHTETVSPLPSCMDLLAQGSPDSSTSPRVKVLPTSAEEITAKKDDPAQGKKQKIRTVFSQTQLYVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKCKRWQKNNWPKNNNTVSQNSSANPEYPGFYSYHQGYLMNTSGNLPIWGNQTWNSQSWSNQTWNSQSWSNQTWNSQSWSNQTWNSQTWCPQAWNGQGWNSQLHDCGEESPQPQIQLQQNSVSDLQSILETTGESHSVIQQTAKYFSAQQIMDLFPNYPEHTA"

     misc_feature    order(292..303,307..309,358..360,376..378,415..417,
                     421..426,433..438,442..450,454..459)
                     /gene="NANOG"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(295..297,304..306,424..426,433..438,445..447)
                     /gene="NANOG"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    298..456
                     /gene="NANOG"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     exon            1..151
                     /gene="NANOG"
                     /inference="alignment:Splign:2.1.0"
     exon            152..417
                     /gene="NANOG"
                     /inference="alignment:Splign:2.1.0"
     exon            418..504
                     /gene="NANOG"
                     /inference="alignment:Splign:2.1.0"
     exon            505..936
                     /gene="NANOG"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgaatacggatccagctcagccccaatgcccgccttgccccgaagcgcccgattctagggactcttctccagtgcctgagattgatgggcctgaagaaaattatgcacccttgcgaatgtcatccgctgagaccccccacacggagaccgtctctcctcttccttcctgcatggatctacttgctcagggcagccccgattcttccaccagccccagagtaaaagtgctgcccacttctgcagaggagatcaccgcgaagaaggacgatccagctcagggcaagaaacagaagatcagaaccgtcttctctcagacccagctatatgtactcaatgatagatttcagaggcagaaatacctcagtctccagcagatgcaagaactttccaacattctgaaccttagctataagcaggttaagacctggttccagaaccagagaatgaaatgcaagaggtggcaaaaaaacaactggccaaagaataacaacactgtgtctcagaacagctctgcaaatccagaatacccaggcttctattcctatcaccagggatacctgatgaacacttccggaaaccttccaatatggggcaaccagacctggaacagccagtcgtggagcaaccagacctggaacagccagtcgtggagcaaccagacctggaacagtcagtcgtggagcaaccagacctggaacagtcagacctggtgcccccaagcctggaatggccagggctggaacagccagctgcacgactgtggagaggaatccccgcagccccagatacagttacagcaaaattctgtcagcgatttgcagtccatcttagaaacgactggggaaagccacagtgtgatacagcaaacggccaagtattttagtgcccagcaaataatggatttattcccaaactaccctgaacatacagcctga

//