GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 05:28:27, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001171401             684 bp    mRNA    linear   MAM 30-AUG-2012
DEFINITION  Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA.
ACCESSION   NM_001171401
VERSION     NM_001171401.1
KEYWORDS    RefSeq.
SOURCE      Oryctolagus cuniculus (rabbit)
  ORGANISM  Oryctolagus cuniculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Lagomorpha;
            Leporidae; Oryctolagus.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from DP001063.1.
FEATURES             Location/Qualifiers
     source          1..684
                     /organism="Oryctolagus cuniculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9986"
                     /chromosome="10"
                     /map="10"
     gene            1..684
                     /gene="HOXA6"
                     /note="homeobox A6"
                     /db_xref="GeneID:100328786"
     CDS             1..684
                     /gene="HOXA6"
                     /codon_start=1
                     /product="homeobox protein Hox-A6"
                     /protein_id="NP_001164872.1"
                     /db_xref="GeneID:100328786"
                     /translation="
MSSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKTYTSPCFYQQSNSVLACNRASYEYGASCFYSDKDLSGASPSGSGKQRGPGDYLHFSPEQQYKPDSSGVQGKALHEEGTDRKYTSPVYPWMQRMNSCAGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSMAAAGGAFRP"
     misc_feature    order(457..471,475..477,526..528,544..546,583..585,
                     589..594,601..606,610..618,622..627)
                     /gene="HOXA6"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(463..465,472..474,592..594,601..606,613..615)
                     /gene="HOXA6"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    466..624
                     /gene="HOXA6"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
ORIGIN      
atgagttcctattttgtgaatcccactttccccgggagcctgcccagcggccaggactccttcttgggccagctgcccctctacccggccggctatgacgcgctgaggcccttcccggcctcgtacggggcgtccagccttccggacaagacgtacacttcaccctgtttctaccaacagtccaactccgtcctggcctgcaaccgggcgtcctacgagtacggggcctcgtgcttctattccgataaggacctcagtggcgcctcgccctcgggcagtggcaagcagaggggcccgggggactacctgcacttttctcccgagcagcagtacaaacccgacagcagcggcgtgcagggcaaagccctccacgaggaaggcaccgaccggaagtacacgagccctgtgtacccctggatgcagcggatgaactcgtgcgcgggcggcccggaaggcaaaagggcccggacggcctacacgcgctaccagacgctggagctggagaaggagttccacttcaaccgctacctgacccgccgcaggaggattgagatagcacatgctctttgcctctctgagagacagattaaaatctggttccaaaaccggagaatgaagtggaaaaaagataataagctgaaaagcatgagcatggcggcggcggggggcgccttccgcccctga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]