GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:14:40, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001169063            1008 bp    mRNA    linear   PRI 21-NOV-2019
DEFINITION  Papio anubis homeobox A1 (HOXA1), mRNA.
ACCESSION   NM_001169063
VERSION     NM_001169063.1
KEYWORDS    RefSeq.
SOURCE      Papio anubis (olive baboon)
  ORGANISM  Papio anubis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from DP000507.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN00000303,
                              SAMN02045697 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1008
                     /organism="Papio anubis"
                     /mol_type="mRNA"
                     /db_xref="taxon:9555"
                     /chromosome="4"
                     /map="4"
     gene            1..1008
                     /gene="HOXA1"
                     /note="homeobox A1"
                     /db_xref="GeneID:100137568"
     CDS             1..1008
                     /gene="HOXA1"
                     /note="homeobox A1, isoform 1"
                     /codon_start=1
                     /product="homeobox protein Hox-A1"
                     /protein_id="NP_001162534.1"
                     /db_xref="GeneID:100137568"
                     /translation="
MDNARMNSFLEYPILSSGDSGTCSARAYPSDHGITTFQSCAVSTNSCGGDDRFLVGRGVQIGSPHQHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSASPCVPSPGSSTSDTLTTSH"
     misc_feature    526..>858
                     /gene="HOXA1"
                     /note="Homeobox protein; Region: Abdominal-A; cl27820"
                     /db_xref="CDD:332641"
     misc_feature    order(697..702,706..708,757..759,775..777,814..816,
                     820..825,832..837,841..849,853..858)
                     /gene="HOXA1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    697..855
                     /gene="HOXA1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:306543"
     misc_feature    order(703..705,823..825,832..837,844..846)
                     /gene="HOXA1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            1..652
                     /gene="HOXA1"
                     /inference="alignment:Splign:2.1.0"
     exon            653..1008
                     /gene="HOXA1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atggacaatgcaagaatgaactccttcctggaataccccatccttagcagtggcgactcggggacctgctcagcccgagcctacccctcggaccatgggattacaactttccagtcgtgcgcggtcagtaccaacagctgcggcggcgacgaccgcttcctagtgggcaggggggtgcagatcggttcgcctcaccaacaccaccaccaccaccatcaccacccccagccggctacctaccagacttccgggaacctgggggtgtcctactctcactcgagttgtggtccaagctatggctcacagaacttcagtgcgccttacagcccctacgcgttaaatcaggaagcagacgtaagtggtgggtacccccagtgcgctcccgctgtttactctggaaatctctcatctcccatggtccagcatcaccaccaccaccagggttatgccgggggcgcggtgggctcgcctcagtacattcaccactcatatggacaagagcaccaaagcctggccctggctacgtataataactccttgtcccctctccacgccagccaccaagaagcctgtcgctcccctgcatcggagacatcttctccagcgcagacttttgactggatgaaagtcaaaagaaaccctcccaaaacagggaaagttggagagtatggctacctgggtcaacccaacgcggtgcgcaccaacttcactaccaagcagctcacggagctggagaaggagttccacttcaacaagtacctgacgcgcgcccgcagggtggagatcgctgcatccctgcagcttaacgagacccaagtgaagatctggttccagaaccgccgaatgaagcaaaagaaacgtgagaaggagggtctcttgcccatctctccagccaccccgccaggaaacgacgagaaggccgaggaatcctcagagaagtccagcgcttcgccctgcgttccttccccggggtcttctacctcagacactctgactacctcccactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]