GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 23:01:06, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001168898             693 bp    mRNA    linear   PRI 21-NOV-2019
DEFINITION  Papio anubis homeobox A7 (HOXA7), mRNA.
ACCESSION   NM_001168898
VERSION     NM_001168898.1
KEYWORDS    RefSeq.
SOURCE      Papio anubis (olive baboon)
  ORGANISM  Papio anubis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from DP000507.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN02045697,
                              SAMN02045698 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..693
                     /organism="Papio anubis"
                     /mol_type="mRNA"
                     /db_xref="taxon:9555"
                     /chromosome="4"
                     /map="4"
     gene            1..693
                     /gene="HOXA7"
                     /note="homeobox A7"
                     /db_xref="GeneID:100137362"
     CDS             1..693
                     /gene="HOXA7"
                     /codon_start=1
                     /product="homeobox protein Hox-A7"
                     /protein_id="NP_001162369.1"
                     /db_xref="GeneID:100137362"
                     /translation="
MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFASTVPGLYNVNSPLYQSPFASGYGLGADAYSNLPCASYDQNIPGLCSDLAKGACDKADEGVLHGPAEANFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEHKDEGPAAAAAPEGAVPSAAATAAADKADEEDDDEEEEDEEE"
     misc_feature    order(391..405,409..411,460..462,478..480,517..519,
                     523..528,535..540,544..552,556..561)
                     /gene="HOXA7"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(397..399,406..408,526..528,535..540,547..549)
                     /gene="HOXA7"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    400..561
                     /gene="HOXA7"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:333795"
     exon            1..379
                     /gene="HOXA7"
                     /inference="alignment:Splign:2.1.0"
     exon            380..693
                     /gene="HOXA7"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgagttcttcgtattatgtgaacgcgctttttagcaaatatacggcgggggcttctctgttccaaaatgccgagccgacttcttgctcctttgcgcccaactcacagagaagcggctacggggcgggcgccggcgccttcgcctcgaccgttccgggcttatacaatgtcaacagccccctttatcagagcccctttgcatccggctacggtctgggcgccgacgcctacagcaacctgccctgcgcctcctacgaccaaaacatccccgggctctgcagtgacctcgccaaaggcgcctgcgacaaggcggacgagggcgtgctgcacggcccagccgaagccaatttccgcatctacccctggatgcggtcttcaggacctgacaggaagcggggccgccagacctacacgcgttaccagacactggagctggagaaggagttccacttcaaccgctacctgacgcggcgccgccgcattgaaatcgcccacgcgctttgcctcaccgagcgccagatcaagatctggttccagaatcgccgcatgaagtggaagaaagagcataaggacgaaggtccggctgccgcagcagctcccgagggcgccgtgccctctgccgccgccaccgctgccgcggacaaggctgacgaggaggacgatgatgaagaagaggaagacgaggaggaatga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]