GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 22:49:37, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_001161645             746 bp    mRNA    linear   MAM 19-FEB-2020
DEFINITION  Sus scrofa claudin 6 (CLDN6), mRNA.
ACCESSION   NM_001161645
VERSION     NM_001161645.1
KEYWORDS    RefSeq.
SOURCE      Sus scrofa (pig)
  ORGANISM  Sus scrofa
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae;
            Sus.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FJ873113.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FJ873113.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..746
                     /organism="Sus scrofa"
                     /mol_type="mRNA"
                     /db_xref="taxon:9823"
                     /chromosome="3"
                     /map="3"
     gene            1..746
                     /gene="CLDN6"
                     /note="claudin 6"
                     /db_xref="GeneID:100302020"
                     /db_xref="VGNC:VGNC:86739"
     exon            1..746
                     /gene="CLDN6"
                     /inference="alignment:Splign:2.1.0"
     CDS             19..684
                     /gene="CLDN6"
                     /codon_start=1
                     /product="claudin-6"
                     /protein_id="NP_001155117.1"
                     /db_xref="GeneID:100302020"
                     /db_xref="VGNC:VGNC:86739"
                     /translation="
MASAGLQILGIVLTLFGWVNALVCCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVITLLVVLLGLLVYLSGAKCTTCVEDKDTKARLVLTSGIIFVLSGVLTLIPVCWTAHAIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGRSQGSSHYMARYSASAPHTASRGPSEYPTKNYV"
     misc_feature    31..528
                     /gene="CLDN6"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
ORIGIN      
ctccacctcagcctcaccatggcctccgctggcctgcaaatcctggggatcgtcctgacgctgtttggctgggtgaatgccctggtgtgctgcgccctgcccctgtggaaggtgaccgccttcatcggcaacagcatcgtggtggcccaggtggtctgggaggggctgtggatgtcctgcgtggtgcagagcacaggccagatgcagtgcaaggtgtatgactcgctgctggcactgccccaggacctgcaggcagcccgtgccctctgtgtcatcactctcctcgtggtcctgctcggcctgctggtctacctctcgggagccaagtgcaccacctgcgtggaggacaaggacaccaaggcccgtctggtgctcacctctgggatcatcttcgtcctctcaggggtgctgaccctgatccccgtgtgctggacggcacacgccatcatccaggacttctacaaccccctagtggctgaggcccagaagcgggagctgggagcctccctctacttgggctgggcggcctctggccttttgttgctgggtggtgggctcctgtgctgcacctgtccctcggggagatcccagggctccagccattatatggcccgatactcggcatcagccccacacactgcctctcggggtccctctgagtaccccactaagaattatgtctaattcgggtgggggtgggggctcccatgacactggcgcctaaccctgagctggaaccacggaga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]