LOCUS       NM_001161643             995 bp    mRNA    linear   MAM 01-JUL-2020
DEFINITION  Sus scrofa claudin 15 (CLDN15), mRNA.
ACCESSION   NM_001161643
VERSION     NM_001161643.1
KEYWORDS    RefSeq.
SOURCE      Sus scrofa (pig)
  ORGANISM  Sus scrofa
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae;
            Sus.
REFERENCE   1  (bases 1 to 995)
  AUTHORS   Uenishi H, Eguchi T, Suzuki K, Sawazaki T, Toki D, Shinkai H,
            Okumura N, Hamasima N and Awata T.
  TITLE     PEDE (Pig EST Data Explorer): construction of a database for ESTs
            derived from porcine full-length cDNA libraries
  JOURNAL   Nucleic Acids Res. 32 (Database issue), D484-D488 (2004)
   PUBMED   14681463
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FJ873104.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FJ873104.1, AK231230.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..995
                     /organism="Sus scrofa"
                     /mol_type="mRNA"
                     /db_xref="taxon:9823"
                     /chromosome="3"
                     /map="3"
     gene            1..995
                     /gene="CLDN15"
                     /note="claudin 15"
                     /db_xref="GeneID:100302018"
                     /db_xref="VGNC:VGNC:86732"
     exon            1..422
                     /gene="CLDN15"
                     /inference="alignment:Splign:2.1.0"
     CDS             206..910
                     /gene="CLDN15"
                     /codon_start=1
                     /product="claudin-15"
                     /protein_id="NP_001155115.1"
                     /db_xref="GeneID:100302018"
                     /db_xref="VGNC:VGNC:86732"
                     /translation="

MSVAVEIFGFFMAALGLVLLGVTLPHSSWRVSTVHGNVITTNTIFENLWYSCATDSLGVYNCWEFPSMLALSGYIQACRALMITAILLGFLGLFLGMVGLRCTNIGGLELSRKTKLAATAGALHILAGVCGMVAISWYAFNITRDFFDPLYPGTKYELGPALYLGWTASLLSILGGICLCSSCCCAQDDDPAANVRVPYKAPMPASSLTARLPAVASDEDGDSSFGKYGKNAYV"

     misc_feature    290..736
                     /gene="CLDN15"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
     exon            423..587
                     /gene="CLDN15"
                     /inference="alignment:Splign:2.1.0"
     exon            588..669
                     /gene="CLDN15"
                     /inference="alignment:Splign:2.1.0"
     exon            670..786
                     /gene="CLDN15"
                     /inference="alignment:Splign:2.1.0"
     exon            787..995
                     /gene="CLDN15"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ttcctctgaccgacctgtggggaagcagagaggcctggagagagggaagacctgggccaaggaagaggcagaggctgcagcctgcctccccctgtccccagcctgcctccaccgccctcctcagccaaagccccttcgagtcccctggggctcagcccctccccctgtcccgggcccgggctgcccgcggggcctgcctcccaccatgtcggtggctgtggagatcttcggcttcttcatggcagccctggggttggtgctgctgggggtgacgctgccgcacagcagctggcgagtgtccaccgtgcacgggaacgtcatcaccaccaacaccatcttcgagaacctctggtacagctgcgccaccgactccctcggggtctacaactgctgggagttcccgtccatgctggccctctcggggtacatccaggcctgccgggcgctcatgatcaccgccatcctcctgggcttcctgggcctcttcctgggcatggtggggctgcgctgcacgaacattgggggcctggagctctccaggaaaaccaagctggcggctaccgcaggggccctacacatactggccggggtctgcgggatggtggctatctcctggtatgccttcaacatcacccgggacttcttcgaccccttgtatccggggaccaagtatgagctgggccccgcgctctacctgggctggaccgcctccctgctctccatcctgggcggcatctgcctctgctccagctgctgctgcgctcaggacgacgacccagcagccaacgtccgggttccctacaaggccccgatgcccgcctccagcctcactgcccgcttgcccgccgtagcctcggatgaagacggcgacagcagcttcggcaagtatgggaaaaacgcttacgtataggaggcctggcccgtggaccacattcgcttcctactgctcccagtggaacccccgggctgcaggcgcgggtccctactccctgtaa

//