2024-03-29 17:00:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001161642 955 bp mRNA linear MAM 19-FEB-2022 DEFINITION Sus scrofa claudin 14 (CLDN14), mRNA. ACCESSION NM_001161642 VERSION NM_001161642.1 KEYWORDS RefSeq. SOURCE Sus scrofa (pig) ORGANISM Sus scrofa Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus. REFERENCE 1 (bases 1 to 955) AUTHORS Uenishi H, Eguchi T, Suzuki K, Sawazaki T, Toki D, Shinkai H, Okumura N, Hamasima N and Awata T. TITLE PEDE (Pig EST Data Explorer): construction of a database for ESTs derived from porcine full-length cDNA libraries JOURNAL Nucleic Acids Res. 32 (Database issue), D484-D488 (2004) PUBMED 14681463 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from FJ873103.1. ##Evidence-Data-START## Transcript is intronless :: FJ873103.1, SRR5250920.181866.1 [ECO:0000345] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..955 /organism="Sus scrofa" /mol_type="mRNA" /db_xref="taxon:9823" /chromosome="13" /map="13" gene 1..955 /gene="CLDN14" /note="claudin 14" /db_xref="GeneID:100302017" /db_xref="VGNC:VGNC:86731" exon 1..955 /gene="CLDN14" /inference="alignment:Splign:2.1.0" misc_feature 107..109 /gene="CLDN14" /note="upstream in-frame stop codon" CDS 140..859 /gene="CLDN14" /codon_start=1 /product="claudin-14" /protein_id="NP_001155114.1" /db_xref="GeneID:100302017" /db_xref="VGNC:VGNC:86731" /translation="
MASTAVQLLGFLLSFLGLVGTLLTTLLPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGVACACAVVGMKCTRCAKGTPAKATFAVLGGVLFLLAGLLCLVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPSRPYQAQPRAGTAAAPTAPAYRPPDAYKDNRAPSAISASYSGYRLNDYV"
misc_feature <269..682 /gene="CLDN14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
ttggtggcagaaataaatgcacccggataatctttaactcctttcctcccccctctccccctgccctgccccgcctccccggttcattaggactcccgcgggcgcctgagccagcgccgccaccgccgccgtcaaggccatggccagcacagccgtgcagctcctgggcttcctgctcagcttcctgggcctggtgggcacgctcctcaccaccctcctgccgcactggcgccgaacagcgcacgtgggcaccaacatcctgacggccgtgtcctacctgaagggcctgtggatggagtgcgtgtggcacagcaccggcatctaccagtgccagatctaccgctcgctgctggcgctgccccgcgacctgcaggcggcccgcgcgctcatggtcatctcctgcctgctgtcgggcgtggcctgcgcctgcgccgtggtcggcatgaagtgcacgcgctgcgccaagggcaccccggccaaggccacgttcgccgtgctgggcggcgtgctcttcctgctggccggcctgctctgcctggtggcggtctcctggaccaccaacgacgtggtacagaacttctacaacccgctgctgcccagcggcatgaagttcgagatcgggcaggccctgtacctgggcttcatctcctcgtccctgtcgctcatcggcggcacgctgctctgcctgtcctgccaggacgaggcgccttccaggccctaccaggcccagccccgggctggcacggccgccgcgcccaccgcgcccgcctaccggccacccgacgcctacaaggacaatcgggccccctcggccatctcggcctcgtacagcgggtacaggctgaacgactatgtgtgagtcgccgggacctgtccctgcctgggcccagagaggtgccgggacccggcccgcctgcggactgcttcaaggttcccacaccgagttcatttctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]