GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-29 05:54:59, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001160099             852 bp    mRNA    linear   ROD 14-NOV-2025
DEFINITION  Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA.
ACCESSION   NM_001160099
VERSION     NM_001160099.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 852)
  AUTHORS   Jasmine, Samtiya,M., Rodrigues,R., Mandal,A., Kavya,T.T.,
            Anushree,A., Lafin,J.T., Vezina,C.M., Strand,D.W. and Binoy
            Joseph,D.
  TITLE     Single cell map of the adult female mouse urethra reveals
            epithelial and stromal macrophages with distinct functional
            identities
  JOURNAL   Mucosal Immunol (2025) In press
   PUBMED   40907791
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 852)
  AUTHORS   Lamprou,A., Porcheri,C. and Mitsiadis,T.A.
  TITLE     Notch2 Deletion Compromises Epithelial Integrity and Enamel
            Formation in Rodent Incisors
  JOURNAL   Cells 14 (15), 1224 (2025)
   PUBMED   40801656
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 852)
  AUTHORS   Patel,V.N., Aure,M.H., Choi,S.H., Ball,J.R., Lane,E.D., Wang,Z.,
            Xu,Y., Zheng,C., Liu,X., Martin,D., Pailin,J.Y., Prochazkova,M.,
            Kulkarni,A.B., van Kuppevelt,T.H., Ambudkar,I.S., Liu,J. and
            Hoffman,M.P.
  TITLE     Specific 3-O-sulfated heparan sulfate domains regulate salivary
            gland basement membrane metabolism and epithelial differentiation
  JOURNAL   Nat Commun 15 (1), 7584 (2024)
   PUBMED   39217171
  REMARK    Erratum:[Nat Commun. 2024 Oct 10;15(1):8784. doi:
            10.1038/s41467-024-53230-4. PMID: 39389981]
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 852)
  AUTHORS   Brideau,G., Cheval,L., Griveau,C., Ling,W.E., Lievre,L.,
            Crambert,G., Muller,D., Brocic,J., Cherchame,E., Houillier,P. and
            Prot-Bertoye,C.
  TITLE     Claudin-10 Expression and the Gene Expression Pattern of Thick
            Ascending Limb Cells
  JOURNAL   Int J Mol Sci 25 (7), 4008 (2024)
   PUBMED   38612818
  REMARK    GeneRIF: Claudin-10 Expression and the Gene Expression Pattern of
            Thick Ascending Limb Cells.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 852)
  AUTHORS   Aure,M.H., Symonds,J.M., Villapudua,C.U., Dodge,J.T., Werner,S.,
            Knosp,W.M. and Hoffman,M.P.
  TITLE     FGFR2 is essential for salivary gland duct homeostasis and
            MAPK-dependent seromucous acinar cell differentiation
  JOURNAL   Nat Commun 14 (1), 6485 (2023)
   PUBMED   37838739
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 852)
  AUTHORS   Kitajiri,S.I., Furuse,M., Morita,K., Saishin-Kiuchi,Y., Kido,H.,
            Ito,J. and Tsukita,S.
  TITLE     Expression patterns of claudins, tight junction adhesion molecules,
            in the inner ear
  JOURNAL   Hear Res 187 (1-2), 25-34 (2004)
   PUBMED   14698084
  REMARK    GeneRIF: Claudin-10 is expressed at the variety of epithelial
            tissues in the coclea of inner ear including Organ of Corti, stria
            vascularis, Reissner's membrane, and spiral limbus.
REFERENCE   7  (bases 1 to 852)
  AUTHORS   VanBuren,V., Piao,Y., Dudekula,D.B., Qian,Y., Carter,M.G.,
            Martin,P.R., Stagg,C.A., Bassey,U.C., Aiba,K., Hamatani,T.,
            Kargul,G.J., Luo,A.G., Kelso,J., Hide,W. and Ko,M.S.
  TITLE     Assembly, verification, and initial annotation of the NIA mouse
            7.4K cDNA clone set
  JOURNAL   Genome Res 12 (12), 1999-2003 (2002)
   PUBMED   12466305
REFERENCE   8  (bases 1 to 852)
  AUTHORS   Turksen,K. and Troy,T.C.
  TITLE     Permeability barrier dysfunction in transgenic mice overexpressing
            claudin 6
  JOURNAL   Development 129 (7), 1775-1784 (2002)
   PUBMED   11923212
REFERENCE   9  (bases 1 to 852)
  AUTHORS   Niimi,T., Nagashima,K., Ward,J.M., Minoo,P., Zimonjic,D.B.,
            Popescu,N.C. and Kimura,S.
  TITLE     claudin-18, a novel downstream target gene for the T/EBP/NKX2.1
            homeodomain transcription factor, encodes lung- and
            stomach-specific isoforms through alternative splicing
  JOURNAL   Mol Cell Biol 21 (21), 7380-7390 (2001)
   PUBMED   11585919
REFERENCE   10 (bases 1 to 852)
  AUTHORS   Morita,K., Sasaki,H., Fujimoto,K., Furuse,M. and Tsukita,S.
  TITLE     Claudin-11/OSP-based tight junctions of myelin sheaths in brain and
            Sertoli cells in testis
  JOURNAL   J Cell Biol 145 (3), 579-588 (1999)
   PUBMED   10225958
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CK794879.1 and AI851016.1.
            
            Summary: This intronless gene encodes a member of the claudin
            family. Claudins are integral membrane proteins and components of
            tight unction strands. Tight junction strands serve as a physical
            barrier to prevent solutes and water from passing freely through
            the paracellular space between epithelial or endothelial cell
            sheets, and also play critical roles in maintaining cell polarity
            and signal transductions. Six alternatively spliced transcript
            variants have been identified, which encode different isoforms with
            distinct electric charge of the first extracellular loop and with
            or without the fourth transmembrane region. These isoforms exhibit
            distinct localization and function in paracellular anion or cation
            permeability. [provided by RefSeq, Aug 2010].
            
            Transcript Variant: This variant (b_v1) differs in the 5' UTR and
            5' coding region, representing use of an alternate promoter, and
            lacks an alternate in-frame exon in the 3' coding region, compared
            to variant a. The resulting isoform (b_i1) has a longer and
            distinct N-terminus and lacks an internal segment including the
            entire fourth transmembrane region, compared to isoform a. This
            variant is expressed in all tissues tested, with lowest expression
            in liver and highest expression in kidney.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN02415122,
                              SAMN02415123 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-504               CK794879.1         1-504
            505-554             CK794879.1         613-662
            555-852             AI851016.1         1-298               c
FEATURES             Location/Qualifiers
     source          1..852
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="14"
                     /map="14 62.55 cM"
     gene            1..852
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="claudin 10"
                     /db_xref="GeneID:58187"
                     /db_xref="MGI:MGI:1913101"
     exon            1..260
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     CDS             41..628
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="isoform b_i1 is encoded by transcript variant b_v1;
                     claudin-10A; claudin 10B"
                     /codon_start=1
                     /product="claudin-10 isoform b_i1"
                     /protein_id="NP_001153571.1"
                     /db_xref="GeneID:58187"
                     /db_xref="MGI:MGI:1913101"
                     /translation="
MASTALEIVAFVVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYFANLWKICVTDSTGVANCKEFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDQAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLYMEQKMGYTYNGPTSAMSSRTKYQGGEGDFKTTGPSKQFDKNAYV"
     misc_feature    50..520
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     exon            261..422
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     exon            423..504
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     exon            505..838
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /inference="alignment:Splign:2.1.0"
     regulatory      736..741
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="hexamer: TATAAA"
     polyA_site      756
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
     regulatory      820..825
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="hexamer: AATAAA"
     polyA_site      838
                     /gene="Cldn10"
                     /gene_synonym="6720456I16Rik; Cldn10a; Cldn10b;
                     D14Ertd728e"
                     /note="major polyA site"
ORIGIN      
gcgggatcgggaaccagcgagagcgccgctgcagcccagcatggctagcacggccttggaaatcgtcgccttcgtagtctccatctcgggctgggtgctagtgtcttccacactgcccaccgactactggaaggtctccaccatcgatggcactgtcatcaccacagccacttattttgccaacctgtggaagatctgcgttaccgattccaccggtgtcgccaactgcaaggagttcccctccatgctggcgttggatggttacatccaggcatgtagaggactaatgatcgctgcggtcagcctgggatttttcggttccatttttgcactctttggaatgaaatgtaccaaagtcggaggctcagatcaagccaaagctaaaattgcttgcttggccgggattgtattcatattgtcaggtctgtgttccatgacaggctgttccctgtatgcaaacaaaatcacaacagaattctttgatcctctttatatggagcaaaaaatgggctacacatacaacggacccacgtctgccatgtcttctcggaccaagtatcaaggcggagaaggagattttaaaaccacaggcccttcaaaacagtttgataaaaatgcctatgtctaaagagctctggcaagctgcctcctgagttttgttgtgcaagagaactgtcctcacaatagtccttccaaggctctcctgtaattactgcttaagctgttttttaaaaatataaatttgaagactgttaattggatgtaaatgttcttatagttatatactaatcattttctgctgtgcctttctgtaagggaaataaacaggttatttacaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]